IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ saito-2011-1 PICOT is a molecule which binds to anamorsin. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Saito Y., Shibayama H., Tanaka H., Tanimura A., Matsumura I., Kanakura Y. Apoptosis - Interactions involving proteins with a function related to apoptosis hiro@bldon.med.osaka-u.ac.jp Mouse testis cDNA Biochem. Biophys. Res. Commun. (0006-291X) 2011 Only protein-protein interactions imex curation saito-2011-2 PICOT is a molecule which binds to anamorsin. in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Saito Y., Shibayama H., Tanaka H., Tanimura A., Matsumura I., Kanakura Y. Apoptosis - Interactions involving proteins with a function related to apoptosis hiro@bldon.med.osaka-u.ac.jp Mouse testis cDNA Biochem. Biophys. Res. Commun. (0006-291X) 2011 Only protein-protein interactions imex curation saito-2011-3 PICOT is a molecule which binds to anamorsin. mouse-ba_f3 Mouse pro B cells IL-3 dependent mouse-baf3 EBI-6922762 ba_f3 Mouse pro B cells IL-3 dependent BA/F3 baf3 Mouse pro B cell line. IL-3 dependent murine pro B cell line established from peripheral blood; apparently derived from BALB/c mouse. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Saito Y., Shibayama H., Tanaka H., Tanimura A., Matsumura I., Kanakura Y. Apoptosis - Interactions involving proteins with a function related to apoptosis hiro@bldon.med.osaka-u.ac.jp Mouse testis cDNA Biochem. Biophys. Res. Commun. (0006-291X) 2011 Only protein-protein interactions imex curation saito-2011-4 PICOT is a molecule which binds to anamorsin. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Saito Y., Shibayama H., Tanaka H., Tanimura A., Matsumura I., Kanakura Y. Apoptosis - Interactions involving proteins with a function related to apoptosis hiro@bldon.med.osaka-u.ac.jp Mouse testis cDNA Biochem. Biophys. Res. Commun. (0006-291X) 2011 Only protein-protein interactions imex curation cpin1_mouse Anamorsin Ciapin1 Cytokine-induced apoptosis inhibitor 1 Fe-S cluster assembly protein DRE2 homolog protein protein mouse Mus musculus Mouse MEEFGISPGQLVAVFWDKSSPEEALKKLVARLQELTGSEGQVFMENVTQLLQSSHKESSFDVILSGVVPGSTSLHSAEVLAEMARILRPGGCLFLKEPVETAEVNNDKMKTASKLCSALTLSGLVEIKELQREALSPEEVQSVQEHLGYHSDSLRSVRVTGKKPNFEVGSSSQLKLPNKKSSSVKPVVDPAAAKLWTLSANDMEDDSVDLIDSDELLDPEDLKRPDPASLKAPSCGEGKKRKACKNCTCGLAEELEREQSKAQSSQPKSACGNCYLGDAFRCANCPYLGMPAFKPGEQVLLSNSNLQDA glrx3_mouse Glutaredoxin-3 Glrx3 Picot Txnl2 PKC-interacting cousin of thioredoxin PKC-theta-interacting protein Thioredoxin-like protein 2 protein protein mouse Mus musculus Mouse MAAGAAEAGEAAVAVVEVGSAQQFEELLRLKTKSLLVVHFWAPWAPQCVQMNDVMAELAKEHPHVSFVKLEAEAVPEVSEKYEISSVPTFLFFKNSQKVDRLDGAHAPELTKKVQRHVSSGAFPPSTNEHLKEDLSLRLKKLTHAAPCMLFMKGTPQEPRCGFSKQMVEILHKHNIQFSSFDIFSDEEVRQGLKTYSNWPTYPQLYVSGELIGGLDIIKELEASEELDTICPKAPKLEERLKVLTNKASVMLFMKGNKQEAKCGFSKQILEILNSTGVEYETFDILEDEEVRQGLKTFSNWPTYPQLYVRGDLVGGLDIVKELKDNGELLPILKGEN ciapin1-glrx3 1172053 n/a 1172057 unspecified role unspecified role bait bait n/a 1172058 unspecified role unspecified role prey prey physical association physical association false false false Supplementary Fig. 1 and 2 glrx3-ciapin1 1172054 n/a 1172057 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false mouse-ba_f3 Mouse pro B cells IL-3 dependent mouse-baf3 EBI-6922762 ba_f3 Mouse pro B cells IL-3 dependent BA/F3 baf3 Mouse pro B cell line. IL-3 dependent murine pro B cell line established from peripheral blood; apparently derived from BALB/c mouse. n/a 1172058 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) physical association physical association false false false Figure 1A ciapin1-glrx3-4 1172055 n/a 1172057 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1172058 unspecified role unspecified role prey prey physical association physical association false false false Figure 1C ciapin1-glrx3-5 1172056 n/a 1172058 unspecified role unspecified role prey prey region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false n/a 1172057 unspecified role unspecified role bait bait region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false 1172076 1172074 physical association physical association false false false Supplementary Figure 1 and 2