IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ wang-2011c-7 Poly(ADP-ribose) (PAR) binding to apoptosis-inducing factor is critical for PAR polymerase-1-dependent cell death (parthanatos). in vitro In vitro filter binding filter binding Filter overlay assay Filter overlay assay autoradiography autoradiography Wang Y., Kim N.S., Haince J.F., Kang H.C., David K.K., Andrabi S.A., Poirier G.G., Dawson V.L., Dawson T.M. Apoptosis - Interactions involving proteins with a function related to apoptosis The origin of histones H1 and H3.1, PARP1 and the P21 peptide were stated by the authors upon email request. vdawson@jhmi.edu; tdawson@jhmi.edu vdawson@jhmi.edu,tdawson@jhmi.edu Sci Signal (null) 2011 Only protein-protein interactions imex curation wang-2011c-1 Poly(ADP-ribose) (PAR) binding to apoptosis-inducing factor is critical for PAR polymerase-1-dependent cell death (parthanatos). in vitro In vitro far western blotting far western blotting Affinity blotting Affinity blotting tag visualisation tag visualisation Wang Y., Kim N.S., Haince J.F., Kang H.C., David K.K., Andrabi S.A., Poirier G.G., Dawson V.L., Dawson T.M. Apoptosis - Interactions involving proteins with a function related to apoptosis The origin of histones H1 and H3.1, PARP1 and the P21 peptide were stated by the authors upon email request. vdawson@jhmi.edu; tdawson@jhmi.edu vdawson@jhmi.edu,tdawson@jhmi.edu Sci Signal (null) 2011 Only protein-protein interactions imex curation wang-2011c-2 Poly(ADP-ribose) (PAR) binding to apoptosis-inducing factor is critical for PAR polymerase-1-dependent cell death (parthanatos). in vitro In vitro emsa electrophoretic mobility shift assay Gel retardation assay band shift band shift Gel retardation assay emsa autoradiography autoradiography Wang Y., Kim N.S., Haince J.F., Kang H.C., David K.K., Andrabi S.A., Poirier G.G., Dawson V.L., Dawson T.M. Apoptosis - Interactions involving proteins with a function related to apoptosis The origin of histones H1 and H3.1, PARP1 and the P21 peptide were stated by the authors upon email request. vdawson@jhmi.edu; tdawson@jhmi.edu vdawson@jhmi.edu,tdawson@jhmi.edu Sci Signal (null) 2011 Only protein-protein interactions imex curation wang-2011c-8 Poly(ADP-ribose) (PAR) binding to apoptosis-inducing factor is critical for PAR polymerase-1-dependent cell death (parthanatos). in vitro In vitro far western blotting far western blotting Affinity blotting Affinity blotting autoradiography autoradiography Wang Y., Kim N.S., Haince J.F., Kang H.C., David K.K., Andrabi S.A., Poirier G.G., Dawson V.L., Dawson T.M. Apoptosis - Interactions involving proteins with a function related to apoptosis The origin of histones H1 and H3.1, PARP1 and the P21 peptide were stated by the authors upon email request. vdawson@jhmi.edu; tdawson@jhmi.edu vdawson@jhmi.edu,tdawson@jhmi.edu Sci Signal (null) 2011 Only protein-protein interactions imex curation wang-2011c-9 Poly(ADP-ribose) (PAR) binding to apoptosis-inducing factor is critical for PAR polymerase-1-dependent cell death (parthanatos). in vitro In vitro comigration in gel comigration in gel electrophoresis comigration in gel autoradiography autoradiography Wang Y., Kim N.S., Haince J.F., Kang H.C., David K.K., Andrabi S.A., Poirier G.G., Dawson V.L., Dawson T.M. Apoptosis - Interactions involving proteins with a function related to apoptosis Co-migration in 20% TBE-PAGE. The origin of histones H1 and H3.1, PARP1 and the P21 peptide were stated by the authors upon email request. vdawson@jhmi.edu; tdawson@jhmi.edu vdawson@jhmi.edu,tdawson@jhmi.edu Sci Signal (null) 2011 Only protein-protein interactions imex curation wang-2011c-5 Poly(ADP-ribose) (PAR) binding to apoptosis-inducing factor is critical for PAR polymerase-1-dependent cell death (parthanatos). human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Wang Y., Kim N.S., Haince J.F., Kang H.C., David K.K., Andrabi S.A., Poirier G.G., Dawson V.L., Dawson T.M. Apoptosis - Interactions involving proteins with a function related to apoptosis The experiment was performed on post-nuclear fractions (cell lysates where the nucleus has been removed) of HeLa cells. The origin of histones H1 and H3.1, PARP1 and the P21 peptide were stated by the authors upon email request. vdawson@jhmi.edu; tdawson@jhmi.edu vdawson@jhmi.edu,tdawson@jhmi.edu Sci Signal (null) 2011 Only protein-protein interactions imex curation wang-2011c-6 Poly(ADP-ribose) (PAR) binding to apoptosis-inducing factor is critical for PAR polymerase-1-dependent cell death (parthanatos). mouse-brain-cortex Mus musculus brain cortex brain_cortex Brain cortex [Cerebral cortex; Cerebrum cortex; Cortex; Pallium] anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Wang Y., Kim N.S., Haince J.F., Kang H.C., David K.K., Andrabi S.A., Poirier G.G., Dawson V.L., Dawson T.M. Apoptosis - Interactions involving proteins with a function related to apoptosis The experiment was performed on post-nuclear fractions (cell lysates where the nucleus has been removed) of primary cultures of mouse cortical neurons. The origin of histones H1 and H3.1, PARP1 and the P21 peptide were stated by the authors upon email request. vdawson@jhmi.edu; tdawson@jhmi.edu vdawson@jhmi.edu,tdawson@jhmi.edu Sci Signal (null) 2011 Only protein-protein interactions imex curation wang-2011c-3 Poly(ADP-ribose) (PAR) binding to apoptosis-inducing factor is critical for PAR polymerase-1-dependent cell death (parthanatos). in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Wang Y., Kim N.S., Haince J.F., Kang H.C., David K.K., Andrabi S.A., Poirier G.G., Dawson V.L., Dawson T.M. Apoptosis - Interactions involving proteins with a function related to apoptosis The origin of histones H1 and H3.1, PARP1 and the P21 peptide were stated by the authors upon email request. vdawson@jhmi.edu; tdawson@jhmi.edu vdawson@jhmi.edu,tdawson@jhmi.edu Sci Signal (null) 2011 Only protein-protein interactions imex curation wang-2011c-4 Poly(ADP-ribose) (PAR) binding to apoptosis-inducing factor is critical for PAR polymerase-1-dependent cell death (parthanatos). mouse-brain-cortex Mus musculus brain cortex brain_cortex Brain cortex [Cerebral cortex; Cerebrum cortex; Cortex; Pallium] anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Wang Y., Kim N.S., Haince J.F., Kang H.C., David K.K., Andrabi S.A., Poirier G.G., Dawson V.L., Dawson T.M. Apoptosis - Interactions involving proteins with a function related to apoptosis The experiment was performed on post-nuclear fractions (cell lysates where the nucleus has been removed) of primary cultures of harlequin (HQ) mouse (with reduced wt-AIF expression) cortical neurons. The origin of histones H1 and H3.1, PARP1 and the P21 peptide were stated by the authors upon email request. vdawson@jhmi.edu; tdawson@jhmi.edu vdawson@jhmi.edu,tdawson@jhmi.edu Sci Signal (null) 2011 Only protein-protein interactions imex curation par poly-ADP-D-ribose poly a poly adenine poly A poly a chemical synthesis Chemical synthesis (Chemical synthesis) aifm1_mouse Apoptosis-inducing factor 1, mitochondrial Programmed cell death protein 8 Aifm1 Aif Pdcd8 protein protein mouse Mus musculus Mouse MFRCGGLAGAFKQKLVPLVRTVYVQRPKQRNRLPGNLFQQWRVPLELQMARQMASSGSSGGKMDNSVLVLIVGLSTIGAGAYAYKTIKEDQKRYNERVMGLGLSPEEKQRRAIASATEGGSVPQIRAPSHVPFLLIGGGTAAFAAARSIRARDPGARVLIVSEDPELPYMRPPLSKELWFSDDPNVTKTLQFRQWNGKERSIYFQPPSFYVSAQDLPNIENGGVAVLTGKKVVHLDVRGNMVKLNDGSQITFEKCLIATGGTPRSLSAIDRAGAEVKSRTTLFRKIGDFRALEKISREVKSITVIGGGFLGSELACALGRKSQASGIEVIQLFPEKGNMGKILPQYLSNWTMEKVKREGVKVMPNAIVQSVGVSGGRLLIKLKDGRKVETDHIVTAVGLEPNVELAKTGGLEIDSDFGGFRVNAELQARSNIWVAGDAACFYDIKLGRRRVEHHDHAVVSGRLAGENMTGAAKPYWHQSMFWSDLGPDVGYEAIGLVDSSLPTVGVFAKATAQDNPKSATEQSGTGIRSESETESEASEITIPPSAPAVPQVPVEGEDYGKGVIFYLRDKVVVGIVLWNVFNRMPIARKIIKDGEQHEDLNEVAKLFNIHED cdn1a_human Cyclin-dependent kinase inhibitor 1 CDKN1A CAP20 CDKN1 CIP1 MDA6 PIC1 SDI1 WAF1 p21 CDK-interacting protein 1 Melanoma differentiation-associated protein 6 protein protein human Homo sapiens Human MSEPAGDVRQNPCGSKACRRLFGPVDSEQLSRDCDALMAGCIQEARERWNFDFVTETPLEGDFAWERVRGLGLPKLYLPTGPRRGRDELGGGRRPGTSPALLQGTAEEDHVDLSLSCTLVPRSGEQAEGSPGGPGDSQGRKRRQTSMTDFYHSKRRLIFSKRKP h31_human Histone H3.1 H3FA H3FL H3FD H3FI H3FH H3FK H3FF H3FJ H3FB Histone H3/a Histone H3/b Histone H3/c Histone H3/d Histone H3/f Histone H3/h Histone H3/i Histone H3/j Histone H3/k Histone H3/l H3C1 HIST1H3A H3C2 HIST1H3B H3C3 H3FC HIST1H3C H3C4 HIST1H3D H3C6 HIST1H3E H3C7 HIST1H3F H3C8 HIST1H3G H3C10 HIST1H3H H3C11 HIST1H3I H3C12 HIST1H3J protein protein human Homo sapiens Human MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA h10_human Histone H1.0 H1-0 H1F0 H1FV Histone H1' Histone H1(0) protein protein human Homo sapiens Human MTENSTSAPAAKPKRAKASKKSTDHPKYSDMIVAAIQAEKNRAGSSRQSIQKYIKSHYKVGENADSQIKLSIKRLVTTGVLKQTKGVGASGSFRLAKSDEPKKSVAFKKTKKEIKKVATPKKASKPKKAASKAPTKKPKATPVKKAKKKLAATPKKAKKPKTVKAKPVKASKPKKAKPVKPKAKSSAKRAGKKK parp1_human Poly [ADP-ribose] polymerase 1 PARP1 ADPRT PPOL NAD(+) ADP-ribosyltransferase 1 Poly[ADP-ribose] synthase 1 ADP-ribosyltransferase diphtheria toxin-like 1 DNA ADP-ribosyltransferase PARP1 Protein poly-ADP-ribosyltransferase PARP1 protein protein human Homo sapiens Human MAESSDKLYRVEYAKSGRASCKKCSESIPKDSLRMAIMVQSPMFDGKVPHWYHFSCFWKVGHSIRHPDVEVDGFSELRWDDQQKVKKTAEAGGVTGKGQDGIGSKAEKTLGDFAAEYAKSNRSTCKGCMEKIEKGQVRLSKKMVDPEKPQLGMIDRWYHPGCFVKNREELGFRPEYSASQLKGFSLLATEDKEALKKQLPGVKSEGKRKGDEVDGVDEVAKKKSKKEKDKDSKLEKALKAQNDLIWNIKDELKKVCSTNDLKELLIFNKQQVPSGESAILDRVADGMVFGALLPCEECSGQLVFKSDAYYCTGDVTAWTKCMVKTQTPNRKEWVTPKEFREISYLKKLKVKKQDRIFPPETSASVAATPPPSTASAPAAVNSSASADKPLSNMKILTLGKLSRNKDEVKAMIEKLGGKLTGTANKASLCISTKKEVEKMNKKMEEVKEANIRVVSEDFLQDVSASTKSLQELFLAHILSPWGAEVKAEPVEVVAPRGKSGAALSKKSKGQVKEEGINKSEKRMKLTLKGGAAVDPDSGLEHSAHVLEKGGKVFSATLGLVDIVKGTNSYYKLQLLEDDKENRYWIFRSWGRVGTVIGSNKLEQMPSKEDAIEHFMKLYEEKTGNAWHSKNFTKYPKKFYPLEIDYGQDEEAVKKLTVNPGTKSKLPKPVQDLIKMIFDVESMKKAMVEYEIDLQKMPLGKLSKRQIQAAYSILSEVQQAVSQGSSDSQILDLSNRFYTLIPHDFGMKKPPLLNNADSVQAKVEMLDNLLDIEVAYSLLRGGSDDSSKDPIDVNYEKLKTDIKVVDRDSEEAEIIRKYVKNTHATTHNAYDLEVIDIFKIEREGECQRYKPFKQLHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCHTSQGDPIGLILLGEVALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSANISLDGVDVPLGTGISSGVNDTSLLYNEYIVYDIAQVNLKYLLKLKFNFKTSLW par-aifm1-2 1187032 n/a 1187041 unspecified role unspecified role bait bait purified purified biotin tag biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chemical synthesis Chemical synthesis (Chemical synthesis) n/a 1187042 unspecified role unspecified role prey prey purified purified Q9Z0X1:p.[Arg588Ala;Lys589Ala;Lys592Ala] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false 1187032 1187032 S4b and S4c Scatchard analysis was performed for this interaction, obtaining the a refined calculation of the specific affinity parameters for the PAR-AIF interaction: Kd = 6.63e-8 M Bmax = 116.208 pmol aifm1-par-8 1187032 n/a 1187042 unspecified role unspecified role bait bait purified purified Q9Z0X1:p.[Arg588Ala;Lys589Ala;Lys592Ala] mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false region sufficient to bind sufficient binding region sufficient to bind mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false chemical synthesis Chemical synthesis (Chemical synthesis) n/a 1187041 unspecified role unspecified role prey prey purified purified 32p radiolabel 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction false false false 1187032 1187032 1e, 3b and S4a The parameters given for this interaction were calculated with the wild-type AIF peptide encomprising the region between aas 567 and 592. The values for the mutant forms are: Double Mutant (arg588ala; lys589ala) Kd = 3.30e-6 M Bmax = 3.9724 pmol Triple Mutant (arg588ala; lys589ala; lys592ala) Kd = 1.07e-4 M Bmax = 1.7709 pmol cdkn1a-par 1187032 n/a 1187041 unspecified role unspecified role prey prey purified purified 32p radiolabel 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chemical synthesis Chemical synthesis (Chemical synthesis) n/a 1187043 unspecified role unspecified role bait bait purified purified p21 peptide sufficient to bind sufficient binding region sufficient to bind range range certain certain sequence position certain false chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction false false false 3b par-hist1h3a-1 1187032 n/a 1187041 unspecified role unspecified role prey prey purified purified 32p radiolabel 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chemical synthesis Chemical synthesis (Chemical synthesis) n/a 1187044 unspecified role unspecified role bait bait purified purified ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false 1e par-aifm1-5 1187033 n/a 1187041 unspecified role unspecified role bait bait purified purified biotin tag biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chemical synthesis Chemical synthesis (Chemical synthesis) n/a 1187042 unspecified role unspecified role prey prey purified purified ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false 1a par-hist1h3a-2 1187033 n/a 1187044 unspecified role unspecified role prey prey purified purified ecoli Escherichia coli (strain K12) n/a 1187041 unspecified role unspecified role bait bait purified purified biotin tag biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction false false false 1a aifm1-par-5 1187034 n/a 1187041 unspecified role unspecified role neutral component neutral component purified purified 32p radiolabel 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chemical synthesis Chemical synthesis (Chemical synthesis) n/a 1187042 unspecified role unspecified role neutral component neutral component purified purified Q9Z0X1:p.[Arg588Ala;Lys589Ala;Lys592Ala] mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false 1b, 3c h1f0-par 1187034 n/a 1187041 unspecified role unspecified role neutral component neutral component purified purified 32p radiolabel 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chemical synthesis Chemical synthesis (Chemical synthesis) n/a 1187045 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false 1b parp1-aifm1 1187035 n/a 1187046 unspecified role unspecified role bait bait purified purified 32p radiolabel 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) n/a 1187042 unspecified role unspecified role prey prey purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false region required to bind necessary binding region required to bind mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false 1f par-aifm1-6 1187035 n/a 1187041 unspecified role unspecified role bait bait purified purified 32p radiolabel 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chemical synthesis Chemical synthesis (Chemical synthesis) n/a 1187042 unspecified role unspecified role prey prey purified purified Q9Z0X1:p.Lys589Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false Q9Z0X1:p.[Arg583Ala;Arg588Ala;Lys589Ala;Lys592Ala] mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false Q9Z0X1:p.[Arg588Leu;Lys589Leu;Lys592Leu] mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false region required to bind necessary binding region required to bind mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false any222-244ala required to bind necessary binding region required to bind mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Q9Z0X1:p.[Arg588Ala;Lys589Ala] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false Q9Z0X1:p.[Arg588Ala;Lys589Ala;Lys592Ala] mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false Q9Z0X1:p.[Arg588Leu;Lys589Leu] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false Q9Z0X1:p.[Arg588Leu;Lys592Leu] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false Q9Z0X1:p.[Lys589Leu;Lys592Leu] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false 1f, 3a, S3a and S3b aifm1-par-7 1187036 n/a 1187042 unspecified role unspecified role neutral component neutral component purified purified Q9Z0X1:p.[Arg588Ala;Lys589Ala;Lys592Ala] mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) n/a 1187041 unspecified role unspecified role neutral component neutral component purified purified 32p radiolabel 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction false false false 1187036 1187036 3d The parameters given for this interaction were calculated with a AIF peptide encomprising the region between aas 567 and 592. hist1h3a-par 1187036 n/a 1187041 unspecified role unspecified role neutral component neutral component purified purified 32p radiolabel 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chemical synthesis Chemical synthesis (Chemical synthesis) n/a 1187044 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false 3d par-aifm1 1187037 n/a 1187042 unspecified role unspecified role prey prey flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false Q9Z0X1:p.[Arg588Ala;Lys589Ala;Lys592Ala] mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false n/a 1187041 unspecified role unspecified role bait bait physical association physical association false false false 1c, S1a, S1b, S7a and S7b Treatment of the cells with MNNG (induces parthanatos) increases the interaction. par-aifm1-1 1187038 n/a 1187042 unspecified role unspecified role prey prey n/a 1187041 unspecified role unspecified role bait bait physical association physical association false false false 1d Treatment of the cells with NMDA (induces parthanatos) increased the interaction. par-aifm1-3 1187039 n/a 1187041 unspecified role unspecified role bait bait purified purified biotin tag biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chemical synthesis Chemical synthesis (Chemical synthesis) n/a 1187042 unspecified role unspecified role prey prey purified purified Q9Z0X1:p.[Arg588Ala;Lys589Ala;Lys592Ala] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false 3e par-aifm1-4 1187040 n/a 1187041 unspecified role unspecified role bait bait n/a 1187042 unspecified role unspecified role prey prey flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Q9Z0X1:p.[Arg588Ala;Lys589Ala;Lys592Ala] mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false 5a and 5b Treatment of the cells with NMDA (induces parthanatos) increased the interaction.