IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ laulier-2011-1 Bcl-2 inhibits nuclear homologous recombination by localizing BRCA1 to the endomembranes. human-rg37 RG37 SV40-immortalized human fibroblasts (derived from GM639 and transfected with pDR-GFP plasmid). rg37 RG37 SV40-immortalized human fibroblasts (derived from GM639 and transfected with pDR-GFP plasmid). confocal microscopy confocal microscopy immunostaining immunostaining Laulier C., Barascu A., Guirouilh-Barbat J., Pennarun G., Le Chalony C., Chevalier F., Palierne G., Bertrand P., Verbavatz J.M., Lopez B.S. Apoptosis - Interactions involving proteins with a function related to apoptosis Origin of BRCA1 construct could not be ascertained, so interactions depicted in figures 7a and 7b could not be curated. bernard.lopez@cea.fr Cancer Res. (0008-5472) 2011 Only protein-protein interactions imex curation Affinomics - Interactions curated for the Affinomics consortium. laulier-2011-2 Bcl-2 inhibits nuclear homologous recombination by localizing BRCA1 to the endomembranes. human-crl_2261 CRL-2261 human B-lymphoblastoid cell line (derived from non-Hodgkin's lymphoma) crl_2261 CRL-2261 human B lymphoblastoid cell line (derived from non-Hodgkin's lymphoma). pla proximity ligation assay pELISA pELISA PLA antibody detection identification by antibody antibody detection Laulier C., Barascu A., Guirouilh-Barbat J., Pennarun G., Le Chalony C., Chevalier F., Palierne G., Bertrand P., Verbavatz J.M., Lopez B.S. Apoptosis - Interactions involving proteins with a function related to apoptosis Origin of BRCA1 construct could not be ascertained, so interactions depicted in figures 7a and 7b could not be curated. bernard.lopez@cea.fr Cancer Res. (0008-5472) 2011 Only protein-protein interactions imex curation Affinomics - Interactions curated for the Affinomics consortium. laulier-2011-3 Bcl-2 inhibits nuclear homologous recombination by localizing BRCA1 to the endomembranes. human-h460 Homo sapiens non-small-cell lung cancer cell line H460 h460 human non-small-cell lung cancer cell line H460 pla proximity ligation assay pELISA pELISA PLA antibody detection identification by antibody antibody detection Laulier C., Barascu A., Guirouilh-Barbat J., Pennarun G., Le Chalony C., Chevalier F., Palierne G., Bertrand P., Verbavatz J.M., Lopez B.S. Apoptosis - Interactions involving proteins with a function related to apoptosis Origin of BRCA1 construct could not be ascertained, so interactions depicted in figures 7a and 7b could not be curated. bernard.lopez@cea.fr Cancer Res. (0008-5472) 2011 Only protein-protein interactions imex curation Affinomics - Interactions curated for the Affinomics consortium. laulier-2011-4 Bcl-2 inhibits nuclear homologous recombination by localizing BRCA1 to the endomembranes. human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 pla proximity ligation assay pELISA pELISA PLA antibody detection identification by antibody antibody detection Laulier C., Barascu A., Guirouilh-Barbat J., Pennarun G., Le Chalony C., Chevalier F., Palierne G., Bertrand P., Verbavatz J.M., Lopez B.S. Apoptosis - Interactions involving proteins with a function related to apoptosis Origin of BRCA1 construct could not be ascertained, so interactions depicted in figures 7a and 7b could not be curated. bernard.lopez@cea.fr Cancer Res. (0008-5472) 2011 Only protein-protein interactions imex curation Affinomics - Interactions curated for the Affinomics consortium. laulier-2011-5 Bcl-2 inhibits nuclear homologous recombination by localizing BRCA1 to the endomembranes. human-rg37 RG37 SV40-immortalized human fibroblasts (derived from GM639 and transfected with pDR-GFP plasmid). rg37 RG37 SV40-immortalized human fibroblasts (derived from GM639 and transfected with pDR-GFP plasmid). pla proximity ligation assay pELISA pELISA PLA antibody detection identification by antibody antibody detection Laulier C., Barascu A., Guirouilh-Barbat J., Pennarun G., Le Chalony C., Chevalier F., Palierne G., Bertrand P., Verbavatz J.M., Lopez B.S. Apoptosis - Interactions involving proteins with a function related to apoptosis Origin of BRCA1 construct could not be ascertained, so interactions depicted in figures 7a and 7b could not be curated. bernard.lopez@cea.fr Cancer Res. (0008-5472) 2011 Only protein-protein interactions imex curation Affinomics - Interactions curated for the Affinomics consortium. laulier-2011-6 Bcl-2 inhibits nuclear homologous recombination by localizing BRCA1 to the endomembranes. human-priess Homo sapiens priess Priess EBV-transformed human lymphoblastoid cell line pla proximity ligation assay pELISA pELISA PLA antibody detection identification by antibody antibody detection Laulier C., Barascu A., Guirouilh-Barbat J., Pennarun G., Le Chalony C., Chevalier F., Palierne G., Bertrand P., Verbavatz J.M., Lopez B.S. Apoptosis - Interactions involving proteins with a function related to apoptosis Origin of BRCA1 construct could not be ascertained, so interactions depicted in figures 7a and 7b could not be curated. bernard.lopez@cea.fr Cancer Res. (0008-5472) 2011 Only protein-protein interactions imex curation Affinomics - Interactions curated for the Affinomics consortium. bcl2_human Apoptosis regulator Bcl-2 BCL2 protein protein human Homo sapiens Human MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPAASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK brca1_human Breast cancer type 1 susceptibility protein BRCA1 RNF53 RING finger protein 53 RING-type E3 ubiquitin transferase BRCA1 protein protein human Homo sapiens Human MDLSALRVEEVQNVINAMQKILECPICLELIKEPVSTKCDHIFCKFCMLKLLNQKKGPSQCPLCKNDITKRSLQESTRFSQLVEELLKIICAFQLDTGLEYANSYNFAKKENNSPEHLKDEVSIIQSMGYRNRAKRLLQSEPENPSLQETSLSVQLSNLGTVRTLRTKQRIQPQKTSVYIELGSDSSEDTVNKATYCSVGDQELLQITPQGTRDEISLDSAKKAACEFSETDVTNTEHHQPSNNDLNTTEKRAAERHPEKYQGSSVSNLHVEPCGTNTHASSLQHENSSLLLTKDRMNVEKAEFCNKSKQPGLARSQHNRWAGSKETCNDRRTPSTEKKVDLNADPLCERKEWNKQKLPCSENPRDTEDVPWITLNSSIQKVNEWFSRSDELLGSDDSHDGESESNAKVADVLDVLNEVDEYSGSSEKIDLLASDPHEALICKSERVHSKSVESNIEDKIFGKTYRKKASLPNLSHVTENLIIGAFVTEPQIIQERPLTNKLKRKRRPTSGLHPEDFIKKADLAVQKTPEMINQGTNQTEQNGQVMNITNSGHENKTKGDSIQNEKNPNPIESLEKESAFKTKAEPISSSISNMELELNIHNSKAPKKNRLRRKSSTRHIHALELVVSRNLSPPNCTELQIDSCSSSEEIKKKKYNQMPVRHSRNLQLMEGKEPATGAKKSNKPNEQTSKRHDSDTFPELKLTNAPGSFTKCSNTSELKEFVNPSLPREEKEEKLETVKVSNNAEDPKDLMLSGERVLQTERSVESSSISLVPGTDYGTQESISLLEVSTLGKAKTEPNKCVSQCAAFENPKGLIHGCSKDNRNDTEGFKYPLGHEVNHSRETSIEMEESELDAQYLQNTFKVSKRQSFAPFSNPGNAEEECATFSAHSGSLKKQSPKVTFECEQKEENQGKNESNIKPVQTVNITAGFPVVGQKDKPVDNAKCSIKGGSRFCLSSQFRGNETGLITPNKHGLLQNPYRIPPLFPIKSFVKTKCKKNLLEENFEEHSMSPEREMGNENIPSTVSTISRNNIRENVFKEASSSNINEVGSSTNEVGSSINEIGSSDENIQAELGRNRGPKLNAMLRLGVLQPEVYKQSLPGSNCKHPEIKKQEYEEVVQTVNTDFSPYLISDNLEQPMGSSHASQVCSETPDDLLDDGEIKEDTSFAENDIKESSAVFSKSVQKGELSRSPSPFTHTHLAQGYRRGAKKLESSEENLSSEDEELPCFQHLLFGKVNNIPSQSTRHSTVATECLSKNTEENLLSLKNSLNDCSNQVILAKASQEHHLSEETKCSASLFSSQCSELEDLTANTNTQDPFLIGSSKQMRHQSESQGVGLSDKELVSDDEERGTGLEENNQEEQSMDSNLGEAASGCESETSVSEDCSGLSSQSDILTTQQRDTMQHNLIKLQQEMAELEAVLEQHGSQPSNSYPSIISDSSALEDLRNPEQSTSEKAVLTSQKSSEYPISQNPEGLSADKFEVSADSSTSKNKEPGVERSSPSKCPSLDDRWYMHSCSGSLQNRNYPSQEELIKVVDVEEQQLEESGPHDLTETSYLPRQDLEGTPYLESGISLFSDDPESDPSEDRAPESARVGNIPSSTSALKVPQLKVAESAQSPAAAHTTDTAGYNAMEESVSREKPELTASTERVNKRMSMVVSGLTPEEFMLVYKFARKHHITLTNLITEETTHVVMKTDAEFVCERTLKYFLGIAGGKWVVSYFWVTQSIKERKMLNEHDFEVRGDVVNGRNHQGPKRARESQDRKIFRGLEICCYGPFTNMPTDQLEWMVQLCGASVVKELSSFTLGTGVHPIVVVQPDAWTEDNGFHAIGQMCEAPVVTREWVLDSVALYQCQELDTYLIPQIPHSHY bcl2-brca1 1437625 n/a 1437631 unspecified role unspecified role neutral component neutral component P10415:p.Gly145Ala mutation mutation certain certain sequence position certain certain certain sequence position certain false n/a 1437632 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false 4a, 4b bcl2-brca1-1 1437626 n/a 1437631 unspecified role unspecified role neutral component neutral component n/a 1437632 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction false false false 7c bcl2-brca1-2 1437627 n/a 1437631 unspecified role unspecified role neutral component neutral component n/a 1437632 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction false false false 7d bcl2-brca1-3 1437628 n/a 1437632 unspecified role unspecified role neutral component neutral component n/a 1437631 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction false false false 7d bcl2-brca1-4 1437629 n/a 1437632 unspecified role unspecified role neutral component neutral component n/a 1437631 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction false false false 7a bcl2-brca1-5 1437630 n/a 1437631 unspecified role unspecified role neutral component neutral component n/a 1437632 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction false false false 7c