IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ zhang-2011c-2 Caveolin-1 mediates Fas-BID signaling in hyperoxia-induced apoptosis. human-beas_2b Human bronchial epithelial cell line BEAS-2B beas_2b Human bronchial epithelial cell line BEAS-2B http://cancerres.aacrjournals.org/cgi/content/abstract/48/7/1904?ijkey=330aa4101c1c77d6fbc2b1fc3d60b4ead4af2511&keytype2=tf_ipsecsha anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Zhang M., Lee S.J., An C., Xu J.F., Joshi B., Nabi I.R., Choi A.M., Jin Y. Apoptosis - Interactions involving proteins with a function related to apoptosis Human origin of Cav-1 in fig 2b stated by author upon request. yjin@rics.bwh.harvard.edu Free Radic. Biol. Med. (0891-5849) 2011 Only protein-protein interactions imex curation zhang-2011c-3 Caveolin-1 mediates Fas-BID signaling in hyperoxia-induced apoptosis. human-beas_2b Human bronchial epithelial cell line BEAS-2B beas_2b Human bronchial epithelial cell line BEAS-2B http://cancerres.aacrjournals.org/cgi/content/abstract/48/7/1904?ijkey=330aa4101c1c77d6fbc2b1fc3d60b4ead4af2511&keytype2=tf_ipsecsha confocal microscopy confocal microscopy immunostaining immunostaining Zhang M., Lee S.J., An C., Xu J.F., Joshi B., Nabi I.R., Choi A.M., Jin Y. Apoptosis - Interactions involving proteins with a function related to apoptosis yjin@rics.bwh.harvard.edu Free Radic. Biol. Med. (0891-5849) 2011 Only protein-protein interactions imex curation zhang-2011c-1 Caveolin-1 mediates Fas-BID signaling in hyperoxia-induced apoptosis. mouse-lung Mus musculus lung anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Zhang M., Lee S.J., An C., Xu J.F., Joshi B., Nabi I.R., Choi A.M., Jin Y. Apoptosis - Interactions involving proteins with a function related to apoptosis yjin@rics.bwh.harvard.edu Free Radic. Biol. Med. (0891-5849) 2011 Only protein-protein interactions imex curation tnr6_human Tumor necrosis factor receptor superfamily member 6 FASLG receptor Apoptosis-mediating surface antigen FAS Apo-1 antigen FAS APT1 TNFRSF6 FAS1 protein protein human Homo sapiens Human MLGIWTLLPLVLTSVARLSSKSVNAQVTDINSKGLELRKTVTTVETQNLEGLHHDGQFCHKPCPPGERKARDCTVNGDEPDCVPCQEGKEYTDKAHFSSKCRRCRLCDEGHGLEVEINCTRTQNTKCRCKPNFFCNSTVCEHCDPCTKCEHGIIKECTLTSNTKCKEEGSRSNLGWLCLLLLPIPLIVWVKRKEVQKTCRKHRKENQGSHESPTLNPETVAINLSDVDLSKYITTIAGVMTLSQVKGFVRKNGVNEAKIDEIKNDNVQDTAEQKVQLLRNWHQLHGKKEAYDTLIKDLKKANLCTLAEKIQTIILKDITSDSENSNFRNEIQSLV fadd_human FAS-associated death domain protein FAS-associating death domain-containing protein Mediator of receptor induced toxicity FADD MORT1 GIG3 Growth-inhibiting gene 3 protein protein protein human Homo sapiens Human MDPFLVLLHSVSSSLSSSELTELKFLCLGRVGKRKLERVQSGLDLFSMLLEQNDLEPGHTELLRELLASLRRHDLLRRVDDFEAGAAAGAAPGEEDLCAAFNVICDNVGKDWRRLARQLKVSDTKIDSIEDRYPRNLTERVRESLRIWKNTEKENATVAHLVGALRSCQMNLVADLVQEVQQARDLQNRSGAMSPMSWNSDASTSEAS cav1_human Caveolin-1 CAV1 CAV protein protein human Homo sapiens Human MSGGKYVDSEGHLYTVPIREQGNIYKPNNKAMADELSEKQVYDAHTKEIDLVNRDPKHLNDDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLSALFGIPMALIWGIYFAILSFLHIWAVVPCIKSFLIEIQCISRVYSIYVHTVCDPLFEAVGKIFSNVRINLQKEI bid_human BH3-interacting domain death agonist p22 BID BID protein protein human Homo sapiens Human MDCEVNNGSSLRDECITNLLVFGFLQSCSDNSFRRELDALGHELPVLAPQWEGYDELQTDGNRSSHSRLGRIEADSESQEDIIRNIARHLAQVGDSMDRSIPPGLVNGLALQLRNTSRSEEDRNRDLATALEQLLQAYPRDMEKEKTMLVLALLLAKKVASHTPSLLRDVFHTTVNFINQNLRTYVRSLARNGMD fadd_mouse FAS-associated death domain protein FAS-associating death domain-containing protein Mediator of receptor induced toxicity Fadd Mort1 protein protein mouse Mus musculus Mouse MDPFLVLLHSLSGSLSGNDLMELKFLCRERVSKRKLERVQSGLDLFTVLLEQNDLERGHTGLLRELLASLRRHDLLQRLDDFEAGTATAAPPGEADLQVAFDIVCDNVGRDWKRLARELKVSEAKMDGIEEKYPRSLSERVRESLKVWKNAEKKNASVAGLVKALRTCRLNLVADLVEEAQESVSKSENMSPVLRDSTVSSSETP casp8_mouse Caspase-8 Casp8 protein protein mouse Mus musculus Mouse MDFQSCLYAIAEELGSEDLAALKFLCLDYIPHKKQETIEDAQKLFLRLREKGMLEEGNLSFLKELLFHISRWDLLVNFLDCNREEMVRELRDPDNAQISPYRVMLFKLSEEVSELELRSFKFLLNNEIPKCKLEDDLSLLEIFVEMEKRTMLAENNLETLKSICDQVNKSLLGKIEDYERSSTERRMSLEGREELPPSVLDEMSLKMAELCDSPREQDSESRTSDKVYQMKNKPRGYCLIINNHDFSKAREDITQLRKMKDRKGTDCDKEALSKTFKELHFEIVSYDDCTANEIHEILEGYQSADHKNKDCFICCILSHGDKGVVYGTDGKEASIYDLTSYFTGSKCPSLSGKPKIFFIQACQGSNFQKGVPDEAGFEQQNHTLEVDSSSHKNYIPDEADFLLGMATVKNCVSYRDPVNGTWYIQSLCQSLRERCPQGDDILSILTGVNYDVSNKDDRRNKGKQMPQPTFTLRKKLFFPP tnr6_mouse Tumor necrosis factor receptor superfamily member 6 Fas Apt1 Tnfrsf6 FASLG receptor Apoptosis-mediating surface antigen FAS Apo-1 antigen protein protein mouse Mus musculus Mouse MLWIWAVLPLVLAGSQLRVHTQGTNSISESLKLRRRVRETDKNCSEGLYQGGPFCCQPCQPGKKKVEDCKMNGGTPTCAPCTEGKEYMDKNHYADKCRRCTLCDEEHGLEVETNCTLTQNTKCKCKPDFYCDSPGCEHCVRCASCEHGTLEPCTATSNTNCRKQSPRNRLWLLTILVLLIPLVFIYRKYRKRKCWKRRQDDPESRTSSRETIPMNASNLSLSKYIPRIAEDMTIQEAKKFARENNIKEGKIDEIMHDSIQDTAEQKVQLLLCWYQSHGKSDAYQDLIKGLKKAECRRTLDKFQDMVQKDLGKSTPDTGNENEGQCLE fas-fadd-4 1174294 n/a 1174297 unspecified role unspecified role bait bait n/a 1174298 unspecified role unspecified role prey prey physical association physical association false false false 2b Hyperoxia conditions were required for the interaction. Overexpression of Cav-1 (Human or mouse??) greatly increased the interaction. cav1-fas-2 1174294 n/a 1174297 unspecified role unspecified role prey prey n/a 1174299 unspecified role unspecified role bait bait physical association physical association false false false 3b and 4b Short-term hyperoxia conditions (4h) increased the interaction detected in whole cell lysates and in lipid raft fractions. After long term exposure to hyperoxia (12-24 h), the increase was only present in the lipid raft fraction of the cell (fig. 3b). Palmitoylation is required for the interaction to happen. The presence of 2-bromopalmitic acid, inhibitor of palmitoylation, decreases the interaction (fig. 4b). fas-cav1 1174294 n/a 1174299 unspecified role unspecified role prey prey n/a 1174297 unspecified role unspecified role bait bait physical association physical association false false false 4a Hyperoxia conditions are required for the interaction to happen. The presence of N-acetylcysteine, a ROS scavenger molecule, decreases the interaction, pointing out a ROS-mediated mechanism of action for the hyperoxia to induce the interaction. cav1-bid 1174294 n/a 1174299 unspecified role unspecified role bait bait Q03135:p.Tyr14Phe mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false n/a 1174300 unspecified role unspecified role prey prey physical association physical association false false false 5d Hyperoxia conditions are required for the interaction to happen. bid-cav1-1 1174294 n/a 1174300 unspecified role unspecified role bait bait n/a 1174299 unspecified role unspecified role prey prey physical association physical association false false false 6c Hyperoxia conditions are required for the interaction to happen. Catalase (P04040) was found to be an agonist of the interaction. Glutathion peroxidase 2 (P18283) was found to be an antagonist of the interaction. fas-fas 1174294 n/a 1174297 unspecified role unspecified role prey prey n/a 1174297 unspecified role unspecified role bait bait physical association physical association false false false 3c cav1-fas 1174295 n/a 1174299 unspecified role unspecified role neutral component neutral component n/a 1174297 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false 3a Hyperoxia conditions are required for the colocalization to occur. bid-cav1 1174295 n/a 1174299 unspecified role unspecified role neutral component neutral component n/a 1174300 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false 5c Hyperoxia conditions are required for the colocalization to occur. fas-casp8-3 1174296 n/a 1174301 unspecified role unspecified role prey prey n/a 1174302 unspecified role unspecified role prey prey n/a 1174303 unspecified role unspecified role bait bait association association false false false 2a The interaction occurs only under hyperoxia conditions. Cav-1 (P49817) is also required.