IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ montessuit-2010-2 Membrane remodeling induced by the dynamin-related protein Drp1 stimulates Bax oligomerization. in vitro In vitro cosedimentation cosedimentation western blot western blot Immuno blot Immuno blot Montessuit S., Somasekharan S.P., Terrones O., Lucken-Ardjomande S., Herzig S., Schwarzenbacher R., Manstein D.J., Bossy-Wetzel E., Basanez G., Meda P., Martinou J.C. Apoptosis - Interactions involving proteins with a function related to apoptosis The assay was performed by checking Bax polymers resistance to trypsin digestion. The polymers were detected only by association with PC/PE/CL (phosphatidylcholine, phosphatidylethanolamine and cardiolipin) liposomes. jean-claude.martinou@unige.ch Cell (0092-8674) 2010 Only protein-protein interactions imex curation montessuit-2010-1 Membrane remodeling induced by the dynamin-related protein Drp1 stimulates Bax oligomerization. in vitro In vitro polymerization polymerization western blot western blot Immuno blot Immuno blot Montessuit S., Somasekharan S.P., Terrones O., Lucken-Ardjomande S., Herzig S., Schwarzenbacher R., Manstein D.J., Bossy-Wetzel E., Basanez G., Meda P., Martinou J.C. Apoptosis - Interactions involving proteins with a function related to apoptosis The assay was performed by checking Bax polymers resistance to trypsin digestion. The polymers were detected only by association with PC/PE/CL (phosphatidylcholine, phosphatidylethanolamine and cardiolipin) liposomes. jean-claude.martinou@unige.ch Cell (0092-8674) 2010 Only protein-protein interactions imex curation montessuit-2010-3 Membrane remodeling induced by the dynamin-related protein Drp1 stimulates Bax oligomerization. human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Montessuit S., Somasekharan S.P., Terrones O., Lucken-Ardjomande S., Herzig S., Schwarzenbacher R., Manstein D.J., Bossy-Wetzel E., Basanez G., Meda P., Martinou J.C. Apoptosis - Interactions involving proteins with a function related to apoptosis The assay was performed by checking Bax polymers resistance to trypsin digestion. The polymers were detected only by association with PC/PE/CL (phosphatidylcholine, phosphatidylethanolamine and cardiolipin) liposomes. jean-claude.martinou@unige.ch Cell (0092-8674) 2010 Only protein-protein interactions imex curation montessuit-2010-4 Membrane remodeling induced by the dynamin-related protein Drp1 stimulates Bax oligomerization. in vitro In vitro gtpase assay gtpase assay GTPase gtp hydrolisis gtp hydrolisis GTPase predetermined predetermined participant predetermined Montessuit S., Somasekharan S.P., Terrones O., Lucken-Ardjomande S., Herzig S., Schwarzenbacher R., Manstein D.J., Bossy-Wetzel E., Basanez G., Meda P., Martinou J.C. Apoptosis - Interactions involving proteins with a function related to apoptosis The assay was performed by checking Bax polymers resistance to trypsin digestion. The polymers were detected only by association with PC/PE/CL (phosphatidylcholine, phosphatidylethanolamine and cardiolipin) liposomes. jean-claude.martinou@unige.ch Cell (0092-8674) 2010 Only protein-protein interactions imex curation montessuit-2010-5 Membrane remodeling induced by the dynamin-related protein Drp1 stimulates Bax oligomerization. in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column western blot western blot Immuno blot Immuno blot Montessuit S., Somasekharan S.P., Terrones O., Lucken-Ardjomande S., Herzig S., Schwarzenbacher R., Manstein D.J., Bossy-Wetzel E., Basanez G., Meda P., Martinou J.C. Apoptosis - Interactions involving proteins with a function related to apoptosis The assay was performed by checking Bax polymers resistance to trypsin digestion. The polymers were detected only by association with PC/PE/CL (phosphatidylcholine, phosphatidylethanolamine and cardiolipin) liposomes. jean-claude.martinou@unige.ch Cell (0092-8674) 2010 Only protein-protein interactions imex curation montessuit-2010-6 Membrane remodeling induced by the dynamin-related protein Drp1 stimulates Bax oligomerization. human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 crosslink cross-linking study crosslink western blot western blot Immuno blot Immuno blot Montessuit S., Somasekharan S.P., Terrones O., Lucken-Ardjomande S., Herzig S., Schwarzenbacher R., Manstein D.J., Bossy-Wetzel E., Basanez G., Meda P., Martinou J.C. Apoptosis - Interactions involving proteins with a function related to apoptosis The assay was performed by checking Bax polymers resistance to trypsin digestion. The polymers were detected only by association with PC/PE/CL (phosphatidylcholine, phosphatidylethanolamine and cardiolipin) liposomes. jean-claude.martinou@unige.ch Cell (0092-8674) 2010 Only protein-protein interactions imex curation bid_mouse BH3-interacting domain death agonist p22 BID Bid protein protein mouse Mus musculus Mouse MDSEVSNGSGLGAEHITDLLVFGFLQSSGCTRQELEVLGRELPVQAYWEADLEDELQTDGSQASRSFNQGRIEPDSESQEEIIHNIARHLAQIGDEMDHNIQPTLVRQLAAQFMNGSLSEEDKRNCLAKALDEVKTAFPRDMENDKAMLIMTMLLAKKVASHAPSLLRDVFHTTVNFINQNLFSYVRNLVRNEMD cardiolipin 1',3'-bis(1,2-diacyl-sn-glycero-3-phospho)-sn-glycerol small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) o00429-4 Dynamin-1-like protein HdynIV-37 DLP1b DNM1L DLP1 DRP1 Dnm1p/Vps1p-like protein Dynamin family member proline-rich carboxyl-terminal domain less Dynamin-like protein Dynamin-like protein 4 Dynamin-like protein IV Dynamin-related protein 1 protein protein human Homo sapiens Human MEALIPVINKLQDVFNTVGADIIQLPQIVVVGTQSSGKSSVLESLVGRDLLPRGTGIVTRRPLILQLVHVSQEDKRKTTGEENGVEAEEWGKFLHTKNKLYTDFDEIRQEIENETERISGNNKGVSPEPIHLKIFSPNVVNLTLVDLPGMTKVPVGDQPKDIELQIRELILRFISNPNSIILAVTAANTDMATSEALKISREVDPDGRRTLAVITKLDLMDAGTDAMDVLMGRVIPVKLGIIGVVNRSQLDINNKKSVTDSIRDEYAFLQKKYPSLANRNGTKYLARTLNRLLMHHIRDCLPELKTRINVLAAQYQSLLNSYGEPVDDKSATLLQLITKFATEYCNTIEGTAKYIETSELCGGARICYIFHETFGRTLESVDPLGGLNTIDILTAIRNATGPRPALFVPEVSFELLVKRQIKRLEEPSLRCVELVHEEMQRIIQHCSNYSTQELLRFPKLHDAIVEVVTCLLRKRLPVTNEMVHNLVAIELAYINTKHPDFADACGLMNNNIEEQRRNRLARELPSAVSRDKVASGGGGVGDGVQEPTTGNWRGMLKTSKAEELLAEEKSKPIPIMPASPQKGHAVNLLDVPVPVARKLSAREQRDCEVIERLIKSYFLIVRKNIQDSVPKAVMHFLVNHVKDTLQSELVGQLYKSSLLDDLLTESEDMAQRRKEAADMLKALQGASQIIAEIRETHLW fis1_human Mitochondrial fission 1 protein FIS1 TTC11 FIS1 homolog Tetratricopeptide repeat protein 11 CGI-135 protein protein human Homo sapiens Human MEAVLNELVSVEDLLKFEKKFQSEKAAGSVSKSTQFEYAWCLVRSKYNDDIRKGIVLLEELLPKGSKEEQRDYVFYLAVGNYRLKEYEKALKYVRGLLQTEPQNNQAKELERLIDKAMKKDGLVGMAIVGGMALGVAGLAGLIGLAVSKSKS bax_human Apoptosis regulator BAX BAX BCL2L4 Bcl-2-like protein 4 protein protein human Homo sapiens Human MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGTPTWQTVTIFVAGVLTASLTIWKKMG gtp guanosine triphosphate - GTP 5'-GTP GTP Guanosine 5'-triphosphate guanosine 5'-triphosphoric acid guanosine triphosphate GUANOSINE-5'-TRIPHOSPHATE H4gtp guanosine 5'-(tetrahydrogen triphosphate) small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) InChI=1/C10H16N5O14P3/c11-10-13-7-4(8(18)14-10)12-2-15(7)9-6(17)5(16)3(27-9)1-26-31(22,23)29-32(24,25)28-30(19,20)21/h2-3,5-6,9,16-17H,1H2,(H,22,23)(H,24,25)(H2,19,20,21)(H3,11,13,14,18)/t3-,5-,6-,9-/m1/s1/f/h14,19-20,22,24H,11H2 cardiolipin-bid 1187290 n/a 1187296 unspecified role unspecified role prey prey purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) n/a 1187297 unspecified role unspecified role bait bait purified purified chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction false false false 2b cardiolipin-dnm1l-1 1187290 n/a 1187298 unspecified role unspecified role prey prey purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) n/a 1187297 unspecified role unspecified role bait bait purified purified chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction false false false 2b cardiolipin-fis-1 1187290 n/a 1187299 unspecified role unspecified role prey prey purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) n/a 1187297 unspecified role unspecified role bait bait purified purified chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction false false false 2b bax-bax-1 1187291 n/a 1187300 unspecified role unspecified role neutral component neutral component purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) n/a 1187300 unspecified role unspecified role neutral component neutral component purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) physical association physical association false false false 1d, 2a, 2e, 2f, 4g and 4h The presence of tBid and Drp1 as assistant proteins (fig. 1d) and cardiolipin as an integrant part of the liposomes (fig. 2a and 2b) was required for the oligomerization to happen. Drp1 mutants R247A and R247E (defficient in membrane fusion activity) could not promote oligonmerization of Bax (fig. 2e). Cytochrome C also increases Bax oligomerization (fig. 4f). The presence of LPC (lyso-phosphatidylcholine), which induces a positive curvature in lipid membranes, can disrupt Bax oligomerization in a dose-dependent manner. dnm1l-dnm1l-1 1187292 n/a 1187298 unspecified role unspecified role prey prey O00429-4:p.Lys38Ala mutation mutation certain certain sequence position certain certain certain sequence position certain false ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false O00429-4:p.Arg247Ala mutation mutation certain certain sequence position certain certain certain sequence position certain false n/a 1187298 unspecified role unspecified role bait bait cfp tag cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false S4 dnm1l-gtp 1187293 n/a 1187298 enzyme enzyme unspecified role unspecified role purified purified n-terminal region of gtp-ase domain required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false O00429-4:p.[Thr59Ala;Pro159Ala;Lys216Ala] mutation mutation mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false O00429-4:p.Lys38Ala mutation mutation mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) n/a 1187301 enzyme target enzyme target substrate substrate unspecified role unspecified role gtpase reaction gtpase reaction false false false 2d Key amino acids in the GTPase domain were mutated to produce GTPase-deficient mutants (Drp1 K38A, T59A/G149A/K216A) dnm1l-dnm1l-2 1187294 n/a 1187298 unspecified role unspecified role neutral component neutral component purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) Stoichiometry: 4.0 direct interaction direct interaction false false false 2h Protein is tetrameric in the presence of ATP, dimeric in its absence. bax-bax-2 1187295 n/a 1187300 unspecified role unspecified role neutral component neutral component n/a 1187300 unspecified role unspecified role neutral component neutral component physical association physical association false false false S5 The presence of Drp1 increases Bax oligomerization.