UniProt UniProt http://www.uniprot.org fan-2010a-2 SIRT1 regulates UV-induced DNA repair through deacetylating XPA. human-h1299 Homo sapiens lung lymph node carcinoma h1299 Human lung lymph node carcinoma p53 null. These cells have also been reported to secrete the peptide hormone neuromedin B (NMB), but not gastrin releasing peptide (GRP). Also known as NCI H1299 or CRL-5803. http://www.lgcpromochem.com/atcc/ ATCC number: CRL-5803. ATCC number of the cell line is CRL-5803. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Fan W., Luo J. Apoptosis - Interactions involving proteins with a function related to apoptosis XPA plasmids and purified protein from Zou J., who worked with human proteins, see pmid 12390028. SIRT1 plasmids according pmid 11672522. In vitro acetylation assay using p300 omitted its species origin can not be established from the publication. CoIP exp fig7A omitted as host cannot be established from the publication. jluo@som.umaryland.edu Mol. Cell (1097-2765) 2010 Only protein-protein interactions imex curation fan-2010a-4 SIRT1 regulates UV-induced DNA repair through deacetylating XPA. human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Fan W., Luo J. Apoptosis - Interactions involving proteins with a function related to apoptosis XPA plasmids and purified protein from Zou J., who worked with human proteins, see pmid 12390028. SIRT1 plasmids according pmid 11672522. In vitro acetylation assay using p300 omitted its species origin can not be established from the publication. CoIP exp fig7A omitted as host cannot be established from the publication. jluo@som.umaryland.edu Mol. Cell (1097-2765) 2010 Only protein-protein interactions imex curation fan-2010a-5 SIRT1 regulates UV-induced DNA repair through deacetylating XPA. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Fan W., Luo J. Apoptosis - Interactions involving proteins with a function related to apoptosis XPA plasmids and purified protein from Zou J., who worked with human proteins, see pmid 12390028. SIRT1 plasmids according pmid 11672522. In vitro acetylation assay using p300 omitted its species origin can not be established from the publication. CoIP exp fig7A omitted as host cannot be established from the publication. jluo@som.umaryland.edu Mol. Cell (1097-2765) 2010 Only protein-protein interactions imex curation fan-2010a-1 SIRT1 regulates UV-induced DNA repair through deacetylating XPA. human-h1299 Homo sapiens lung lymph node carcinoma h1299 Human lung lymph node carcinoma p53 null. These cells have also been reported to secrete the peptide hormone neuromedin B (NMB), but not gastrin releasing peptide (GRP). Also known as NCI H1299 or CRL-5803. http://www.lgcpromochem.com/atcc/ ATCC number: CRL-5803. ATCC number of the cell line is CRL-5803. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Fan W., Luo J. Apoptosis - Interactions involving proteins with a function related to apoptosis XPA plasmids and purified protein from Zou J., who worked with human proteins, see pmid 12390028. SIRT1 plasmids according pmid 11672522. In vitro acetylation assay using p300 omitted its species origin can not be established from the publication. CoIP exp fig7A omitted as host cannot be established from the publication. jluo@som.umaryland.edu Mol. Cell (1097-2765) 2010 Only protein-protein interactions imex curation fan-2010a-3 SIRT1 regulates UV-induced DNA repair through deacetylating XPA. in vitro In vitro deacetylase assay deacetylase assay autoradiography autoradiography Fan W., Luo J. Apoptosis - Interactions involving proteins with a function related to apoptosis XPA plasmids and purified protein from Zou J., who worked with human proteins, see pmid 12390028. SIRT1 plasmids according pmid 11672522. In vitro acetylation assay using p300 omitted its species origin can not be established from the publication. CoIP exp fig7A omitted as host cannot be established from the publication. jluo@som.umaryland.edu Mol. Cell (1097-2765) 2010 Only protein-protein interactions imex curation xpa_human DNA repair protein complementing XP-A cells XPA XPAC Xeroderma pigmentosum group A-complementing protein protein protein human Homo sapiens Human MAAADGALPEAAALEQPAELPASVRASIERKRQRALMLRQARLAARPYSATAAAATGGMANVKAAPKIIDTGGGFILEEEEEEEQKIGKVVHQPGPVMEFDYVICEECGKEFMDSYLMNHFDLPTCDNCRDADDKHKLITKTEAKQEYLLKDCDLEKREPPLKFIVKKNPHHSQWGDMKLYLKLQIVKRSLEVWGSQEALEEAKEVRQENREKMKQKKFDKKVKELRRAVRSSVWKRETIVHQHEYGPEENLEDDMYRKTCTMCGHELTYEKM sir1_human NAD-dependent protein deacetylase sirtuin-1 NAD-dependent protein deacylase sirtuin-1 SIRT1 SIR2L1 SIR2-like protein 1 Regulatory protein SIR2 homolog 1 protein protein human Homo sapiens Human MADEAALALQPGGSPSAAGADREAASSPAGEPLRKRPRRDGPGLERSPGEPGGAAPEREVPAAARGCPGAAAAALWREAEAEAAAAGGEQEAQATAAAGEGDNGPGLQGPSREPPLADNLYDEDDDDEGEEEEEAAAAAIGYRDNLLFGDEIITNGFHSCESDEEDRASHASSSDWTPRPRIGPYTFVQQHLMIGTDPRTILKDLLPETIPPPELDDMTLWQIVINILSEPPKRKKRKDINTIEDAVKLLQECKKIIVLTGAGVSVSCGIPDFRSRDGIYARLAVDFPDLPDPQAMFDIEYFRKDPRPFFKFAKEIYPGQFQPSLCHKFIALSDKEGKLLRNYTQNIDTLEQVAGIQRIIQCHGSFATASCLICKYKVDCEAVRGDIFNQVVPRCPRCPADEPLAIMKPEIVFFGENLPEQFHRAMKYDKDEVDLLIVIGSSLKVRPVALIPSSIPHEVPQILINREPLPHLHFDVELLGDCDVIINELCHRLGGEYAKLCCNPVKLSEITEKPPRTQKELAYLSELPPTPLHVSEDSSSPERTSPPDSSVIVTLLDQAAKSNDDLDVSESKGCMEEKPQEVQTSRNVESIAEQMENPDLKNVGSSTGEKNERTSVAGTVRKCWPNRVAKEQISRRLDGNQYLFLPPNRYIFHGAEVYSDSEDDVLSSSSCGSNSDSGTCQSPSLEEPMEDESEIEEFYNGLEDEPDVPERAGGAGFGTDGDDQEAINEAISVKQEVTDMNYPSNKS rfa2_human Replication protein A 32 kDa subunit RPA34 Replication protein A 34 kDa subunit Replication factor A protein 2 RPA2 REPA2 RPA32 protein protein human Homo sapiens Human MWNSGFESYGSSSYGGAGGYTQSPGGFGSPAPSQAEKKSRARAQHIVPCTISQLLSATLVDEVFRIGNVEISQVTIVGIIRHAEKAPTNIVYKIDDMTAAPMDVRQWVDTDDTSSENTVVPPETYVKVAGHLRSFQNKKSLVAFKIMPLEDMNEFTTHILEVINAHMVLSKANSQPSAGRAPISNPGMSEAGNFGGNSFMPANGLTVAQNQVLNLIKACPRPEGLNFQDLKNQLKHMSVSSIKQAVDFLSNEGHIYSTVDDDHFKSTDAE xpa-sirt1 1243027 n/a 1243032 unspecified role unspecified role bait bait n/a 1243033 unspecified role unspecified role prey prey physical association physical association false false false 2C and S4 sirt1-xpa-2 1243027 n/a 1243032 unspecified role unspecified role prey prey n/a 1243033 unspecified role unspecified role bait bait physical association physical association false false false 2C and S4 xpa-rpa2 1243027 n/a 1243034 unspecified role unspecified role prey prey n/a 1243032 unspecified role unspecified role bait bait physical association physical association false false false 7C xpa-rpa2-1 1243028 n/a 1243034 unspecified role unspecified role prey prey n/a 1243032 unspecified role unspecified role bait bait physical association physical association false false false S7 xpa-sirt1-2 1243028 n/a 1243033 unspecified role unspecified role prey prey n/a 1243032 unspecified role unspecified role bait bait physical association physical association false false false S4 sirt1-xpa-5 1243028 n/a 1243032 unspecified role unspecified role prey prey n/a 1243033 unspecified role unspecified role bait bait physical association physical association false false false S4 sirt1-xpa-4 1243029 n/a 1243032 unspecified role unspecified role prey prey n/a 1243033 unspecified role unspecified role bait bait physical association physical association false false false S3A xpa-sirt1-1 1243029 n/a 1243032 unspecified role unspecified role bait bait n/a 1243033 unspecified role unspecified role prey prey physical association physical association false false false S3B sirt1-xpa 1243030 n/a 1243032 unspecified role unspecified role prey prey n/a 1243033 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 2B sirt1-xpa-3 1243031 n/a 1243032 enzyme target enzyme target substrate substrate neutral component neutral component region ac1res monoacetylated residue Acetyl Acetylation (N terminus, N epsilon of Lysine, O of Serine) (Ac) Acetylation Ac1Res undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1243033 enzyme enzyme neutral component neutral component deacetylation deacetylation reaction deacetylation false false false 4B