I2D I2D craik-2010-1 The BH3-only protein Bad confers breast cancer taxane sensitivity through a nonapoptotic mechanism. human-mcf7 Homo sapiens mammary carcinoma cells mcf7 mammary carcinoma cells anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Craik AC., Veldhoen RA., Czernick M., Buckland TW., Kyselytzia K., Ghosh S., Lai R., Damaraju S., Underhill DA., Mackey JR., Goping IS. Apoptosis - Interactions involving proteins with a function related to apoptosis igoping@ualberta.ca Oncogene (0950-9232) 2010 Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database Cancer - Interactions investigated in the context of cancer q07817-1 Bcl-2-like protein 1 BCLX Apoptosis regulator Bcl-X BCL2L1 BCL2L Bcl-xL protein protein human Homo sapiens Human MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLADSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK bad_human Bcl2-associated agonist of cell death Bcl-2-binding component 6 Bcl-2-like protein 8 BAD BBC6 BCL2L8 Bcl-xL/Bcl-2-associated death promoter Bcl2 antagonist of cell death protein protein human Homo sapiens Human MFQIPEFEPSEQEDSSSAERGLGPSPAGDGPSGSGKHHRQAPGLLWDASHQQEQPTSSSHHGGAGAVEIRSRHSSYPAGTEDDEGMGEEPSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSFKKGLPRPKSAGTATQMRQSSSWTRVFQSWWDRNLGRGSSAPSQ bad-bcl-xl 994500 n/a 994501 unspecified role unspecified role prey prey n/a 994502 unspecified role unspecified role bait bait physical association physical association false false false Fig. 4c,d bad-bcl-xl-2 994500 n/a 994501 unspecified role unspecified role bait bait n/a 994502 unspecified role unspecified role prey prey physical association physical association false false false Fig. 4c Paclitaxel