MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint landes-2010-9 The BH3-only Bnip3 binds to the dynamin Opa1 to promote mitochondrial fragmentation and apoptosis by distinct mechanisms. human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Landes T., Emorine L.J., Courilleau D., Rojo M., Belenguer P., Arnaune-Pelloquin L. Apoptosis - Interactions involving proteins with a function related to apoptosis This experiment was performed using cross-linked mitochondrial fraction of HeLa cells. pascale.belenguer@cict.fr EMBO Rep. (1469-221X) 2010 Only protein-protein interactions imex curation landes-2010-1 The BH3-only Bnip3 binds to the dynamin Opa1 to promote mitochondrial fragmentation and apoptosis by distinct mechanisms. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Landes T., Emorine L.J., Courilleau D., Rojo M., Belenguer P., Arnaune-Pelloquin L. Apoptosis - Interactions involving proteins with a function related to apoptosis pascale.belenguer@cict.fr EMBO Rep. (1469-221X) 2010 Only protein-protein interactions imex curation landes-2010-2 The BH3-only Bnip3 binds to the dynamin Opa1 to promote mitochondrial fragmentation and apoptosis by distinct mechanisms. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Landes T., Emorine L.J., Courilleau D., Rojo M., Belenguer P., Arnaune-Pelloquin L. Apoptosis - Interactions involving proteins with a function related to apoptosis pascale.belenguer@cict.fr EMBO Rep. (1469-221X) 2010 Only protein-protein interactions imex curation landes-2010-3 The BH3-only Bnip3 binds to the dynamin Opa1 to promote mitochondrial fragmentation and apoptosis by distinct mechanisms. in vitro In vitro pull down pull down weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Landes T., Emorine L.J., Courilleau D., Rojo M., Belenguer P., Arnaune-Pelloquin L. Apoptosis - Interactions involving proteins with a function related to apoptosis pascale.belenguer@cict.fr EMBO Rep. (1469-221X) 2010 Only protein-protein interactions imex curation landes-2010-4 The BH3-only Bnip3 binds to the dynamin Opa1 to promote mitochondrial fragmentation and apoptosis by distinct mechanisms. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Landes T., Emorine L.J., Courilleau D., Rojo M., Belenguer P., Arnaune-Pelloquin L. Apoptosis - Interactions involving proteins with a function related to apoptosis This experiment was performed using a recombinant protein as a bait and the prey was pulled-down from a mitochondrial extract. pascale.belenguer@cict.fr EMBO Rep. (1469-221X) 2010 Only protein-protein interactions imex curation landes-2010-5 The BH3-only Bnip3 binds to the dynamin Opa1 to promote mitochondrial fragmentation and apoptosis by distinct mechanisms. human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Landes T., Emorine L.J., Courilleau D., Rojo M., Belenguer P., Arnaune-Pelloquin L. Apoptosis - Interactions involving proteins with a function related to apoptosis This experiment was performed using cross-linked mitochondrial fraction of HeLa cells. pascale.belenguer@cict.fr EMBO Rep. (1469-221X) 2010 Only protein-protein interactions imex curation landes-2010-6 The BH3-only Bnip3 binds to the dynamin Opa1 to promote mitochondrial fragmentation and apoptosis by distinct mechanisms. human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Landes T., Emorine L.J., Courilleau D., Rojo M., Belenguer P., Arnaune-Pelloquin L. Apoptosis - Interactions involving proteins with a function related to apoptosis This experiment was performed using cross-linked, whole HeLa cells extracts. pascale.belenguer@cict.fr EMBO Rep. (1469-221X) 2010 Only protein-protein interactions imex curation landes-2010-7 The BH3-only Bnip3 binds to the dynamin Opa1 to promote mitochondrial fragmentation and apoptosis by distinct mechanisms. human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Landes T., Emorine L.J., Courilleau D., Rojo M., Belenguer P., Arnaune-Pelloquin L. Apoptosis - Interactions involving proteins with a function related to apoptosis This experiment was performed using cross-linked mitochondrial fraction of HeLa cells. pascale.belenguer@cict.fr EMBO Rep. (1469-221X) 2010 Only protein-protein interactions imex curation landes-2010-8 The BH3-only Bnip3 binds to the dynamin Opa1 to promote mitochondrial fragmentation and apoptosis by distinct mechanisms. human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Landes T., Emorine L.J., Courilleau D., Rojo M., Belenguer P., Arnaune-Pelloquin L. Apoptosis - Interactions involving proteins with a function related to apoptosis This experiment was performed using the mitochondrial fraction of HeLa cells. pascale.belenguer@cict.fr EMBO Rep. (1469-221X) 2010 Only protein-protein interactions imex curation opa1_human Dynamin-like 120 kDa protein, mitochondrial Optic atrophy protein 1 OPA1 KIAA0567 protein protein human Homo sapiens Human MWRLRRAAVACEVCQSLVKHSSGIKGSLPLQKLHLVSRSIYHSHHPTLKLQRPQLRTSFQQFSSLTNLPLRKLKFSPIKYGYQPRRNFWPARLATRLLKLRYLILGSAVGGGYTAKKTFDQWKDMIPDLSEYKWIVPDIVWEIDEYIDFEKIRKALPSSEDLVKLAPDFDKIVESLSLLKDFFTSGSPEETAFRATDRGSESDKHFRKVSDKEKIDQLQEELLHTQLKYQRILERLEKENKELRKLVLQKDDKGIHHRKLKKSLIDMYSEVLDVLSDYDASYNTQDHLPRVVVVGDQSAGKTSVLEMIAQARIFPRGSGEMMTRSPVKVTLSEGPHHVALFKDSSREFDLTKEEDLAALRHEIELRMRKNVKEGCTVSPETISLNVKGPGLQRMVLVDLPGVINTVTSGMAPDTKETIFSISKAYMQNPNAIILCIQDGSVDAERSIVTDLVSQMDPHGRRTIFVLTKVDLAEKNVASPSRIQQIIEGKLFPMKALGYFAVVTGKGNSSESIEAIREYEEEFFQNSKLLKTSMLKAHQVTTRNLSLAVSDCFWKMVRESVEQQADSFKATRFNLETEWKNNYPRLRELDRNELFEKAKNEILDEVISLSQVTPKHWEEILQQSLWERVSTHVIENIYLPAAQTMNSGTFNTTVDIKLKQWTDKQLPNKAVEVAWETLQEEFSRFMTEPKGKEHDDIFDKLKEAVKEESIKRHKWNDFAEDSLRVIQHNALEDRSISDKQQWDAAIYFMEEALQARLKDTENAIENMVGPDWKKRWLYWKNRTQEQCVHNETKNELEKMLKCNEEHPAYLASDEITTVRKNLESRGVEVDPSLIKDTWHQVYRRHFLKTALNHCNLCRRGFYYYQRHFVDSELECNDVVLFWRIQRMLAITANTLRQQLTNTEVRRLEKNVKEVLEDFAEDGEKKIKLLTGKRVQLAEDLKKVREIQEKLDAFIEALHQEK bnip3_human BCL2/adenovirus E1B 19 kDa protein-interacting protein 3 BNIP3 NIP3 protein protein human Homo sapiens Human MGDAAADPPGPALPCEFLRPGCGAPLSPGAQLGRGAPTSAFPPPAAEAHPAARRGLRSPQLPSGAMSQNGAPGMQEESLQGSWVELHFSNNGNGGSVPASVSIYNGDMEKILLDAQHESGRSSSKSSHCDSPPRSQTPQDTNRASETDTHSIGEKNSSQSEEDDIERRKEVESILKKNSDWIWDWSSRPENIPPKEFLFKHPKRTATLSMRNTSVMKKGGIFSAEFLKVFLPSLLLSHLLAIGLGIYIGRRLTTSTSTF 53967696EDA005E2 opa1-bnip3-6 957469 n/a 957478 unspecified role unspecified role bait bait n/a 957479 unspecified role unspecified role prey prey physical association physical association false false false 1c, S2a right and S2d The interaction requires hypoxia conditions or treatment with CoCl2 to be detected. bnip3-opa1-4 957469 n/a 957478 unspecified role unspecified role prey prey n/a 957479 unspecified role unspecified role bait bait physical association physical association false false false S2d The interaction requires treatment with CoCl2 to be detected. opa1-bnip3-3 957470 n/a 957478 unspecified role unspecified role bait bait fragment sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n/a 957479 unspecified role unspecified role prey prey physical association physical association false false false S1a opa1-bnip3-2 957471 n/a 957478 unspecified role unspecified role bait bait fragment sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n/a 957479 unspecified role unspecified role prey prey physical association physical association false false false text bnip3-opa1 957472 n/a 957479 unspecified role unspecified role bait bait purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) n/a 957478 unspecified role unspecified role prey prey cell lysate cell lysate [35s] labelling 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false rabit-reticulocyte Oryctolagus cuniculus reticulocyte reticulocyte Reticulocytes physical association physical association false false false S1b bnip3-opa1-1 957473 n/a 957478 unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 n/a 957479 unspecified role unspecified role bait bait purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) physical association physical association false false false S1b opa1-bnip3-4 957474 n/a 957478 unspecified role unspecified role bait bait n/a 957479 unspecified role unspecified role prey prey ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false trans-membrane domain (tmd) required to bind necessary binding region required to bind mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false 1a, 1b and S2a left opa1-bnip3-5 957475 n/a 957478 unspecified role unspecified role bait bait n/a 957479 unspecified role unspecified role prey prey ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false S2b bnip3-opa1-2 957476 n/a 957478 unspecified role unspecified role prey prey n/a 957479 unspecified role unspecified role bait bait ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 1a bnip3-opa1-3 957477 n/a 957479 unspecified role unspecified role bait bait ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 957478 unspecified role unspecified role prey prey physical association physical association false false false S2c