IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ sancak-2010-3 Ragulator-Rag complex targets mTORC1 to the lysosomal surface and is necessary for its activation by amino acids. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Sancak Y., Bar-Peled L., Zoncu R., Markhard AL., Nada S., Sabatini DM. Apoptosis - Interactions involving proteins with a function related to apoptosis Untagged proteins visualised by immunostaining with a fluorescently tagged secondary antibody. Source of RRAG family proteins taken from PMID: 18497260 as referenced in the text. Interactions involving Raptor, mTor, S6K1 and Rheb could not be annotated as the source of these proteins could not be traced. sabatini@wi.mit.edu Cell (0092-8674) 2010 Only protein-protein interactions imex curation sancak-2010-2 Ragulator-Rag complex targets mTORC1 to the lysosomal surface and is necessary for its activation by amino acids. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip sequence tag sequence tag identification sequence tag Sancak Y., Bar-Peled L., Zoncu R., Markhard AL., Nada S., Sabatini DM. Apoptosis - Interactions involving proteins with a function related to apoptosis Untagged proteins visualised by immunostaining with a fluorescently tagged secondary antibody. Source of RRAG family proteins taken from PMID: 18497260 as referenced in the text. Interactions involving Raptor, mTor, S6K1 and Rheb could not be annotated as the source of these proteins could not be traced. sabatini@wi.mit.edu Cell (0092-8674) 2010 Only protein-protein interactions imex curation sancak-2010-4 Ragulator-Rag complex targets mTORC1 to the lysosomal surface and is necessary for its activation by amino acids. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Sancak Y., Bar-Peled L., Zoncu R., Markhard AL., Nada S., Sabatini DM. Apoptosis - Interactions involving proteins with a function related to apoptosis Untagged proteins visualised by immunostaining with a fluorescently tagged secondary antibody. Source of RRAG family proteins taken from PMID: 18497260 as referenced in the text. Interactions involving Raptor, mTor, S6K1 and Rheb could not be annotated as the source of these proteins could not be traced. sabatini@wi.mit.edu Cell (0092-8674) 2010 Only protein-protein interactions imex curation sancak-2010-1 Ragulator-Rag complex targets mTORC1 to the lysosomal surface and is necessary for its activation by amino acids. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. fluorescence imaging fluorescence microscopy fluorescence imaging tag fluorescence tag visualisation by fluorescence tag fluorescence Sancak Y., Bar-Peled L., Zoncu R., Markhard AL., Nada S., Sabatini DM. Apoptosis - Interactions involving proteins with a function related to apoptosis Untagged proteins visualised by immunostaining with a fluorescently tagged secondary antibody. Source of RRAG family proteins taken from PMID: 18497260 as referenced in the text. Interactions involving Raptor, mTor, S6K1 and Rheb could not be annotated as the source of these proteins could not be traced. sabatini@wi.mit.edu Cell (0092-8674) 2010 Only protein-protein interactions imex curation rragb_human Ras-related GTP-binding protein B RRAGB protein protein human Homo sapiens Human MEESDSEKTTEKENLGPRMDPPLGEPEGSLGWVLPNTAMKKKVLLMGKSGSGKTSMRSIIFANYIARDTRRLGATILDRIHSLQINSSLSTYSLVDSVGNTKTFDVEHSHVRFLGNLVLNLWDCGGQDTFMENYFTSQRDNIFRNVEVLIYVFDVESRELEKDMHYYQSCLEAILQNSPDAKIFCLVHKMDLVQEDQRDLIFKEREEDLRRLSRPLECSCFRTSIWDETLYKAWSSIVYQLIPNVQQLEMNLRNFAEIIEADEVLLFERATFLVISHYQCKEQRDAHRFEKISNIIKQFKLSCSKLAASFQSMEVRNSNFAAFIDIFTSNTYVMVVMSDPSIPSAATLINIRNARKHFEKLERVDGPKQCLLMR rragd_human Ras-related GTP-binding protein D RRAGD protein protein human Homo sapiens Human MSQVLGKPQPQDEDDAEEEEEEDELVGLADYGDGPDSSDADPDSGTEEGVLDFSDPFSTEVKPRILLMGLRRSGKSSIQKVVFHKMSPNETLFLESTNKICREDVSNSSFVNFQIWDFPGQIDFFDPTFDYEMIFRGTGALIFVIDSQDDYMEALARLHLTVTRAYKVNTDINFEVFIHKVDGLSDDHKIETQRDIHQRANDDLADAGLEKIHLSFYLTSIYDHSIFEAFSKVVQKLIPQLPTLENLLNIFISNSGIEKAFLFDVVSKIYIATDSTPVDMQTYELCCDMIDVVIDISCIYGLKEDGAGTPYDKESTAIIKLNNTTVLYLKEVTKFLALVCFVREESFERKGLIDYNFHCFRKAIHEVFEVRMKVVKSRKVQNRLQKKKRATPNGTPRVLL ltor3_human Ragulator complex protein LAMTOR3 MAP2K1IP1 Mitogen-activated protein kinase kinase 1-interacting protein 1 LAMTOR3 PRO2783 MEK-binding partner 1 MAPKSP1 Late endosomal/lysosomal adaptor and MAPK and MTOR activator 3 Mitogen-activated protein kinase scaffold protein 1 protein protein human Homo sapiens Human MADDLKRFLYKKLPSVEGLHAIVVSDRDGVPVIKVANDNAPEHALRPGFLSTFALATDQGSKLGLSKNKSIICYYNTYQVVQFNRLPLVVSFIASSSANTGLIVSLEKELAPLFEELRQVVEVS ltor2_human Ragulator complex protein LAMTOR2 LAMTOR2 MAPBPIP Late endosomal/lysosomal Mp1-interacting protein Roadblock domain-containing protein 3 Endosomal adaptor protein p14 HSPC003 ROBLD3 Late endosomal/lysosomal adaptor and MAPK and MTOR activator 2 Mitogen-activated protein-binding protein-interacting protein protein protein human Homo sapiens Human MLRPKALTQVLSQANTGGVQSTLLLNNEGSLLAYSGYGDTDARVTAAIASNIWAAYDRNGNQAFNEDNLKFILMDCMEGRVAITRVANLLLCMYAKETVGFGMLKAKAQALVQYLEEPLTQVAAS ltor1_human Ragulator complex protein LAMTOR1 LAMTOR1 PP7157 p27Kip1-releasing factor from RhoA C11orf59 Lipid raft adaptor protein p18 Protein associated with DRMs and endosomes PDRO Late endosomal/lysosomal adaptor and MAPK and MTOR activator 1 protein protein human Homo sapiens Human MGCCYSSENEDSDQDREERKLLLDPSSPPTKALNGAEPNYHSLPSARTDEQALLSSILAKTASNIIDVSAADSQGMEQHEYMDRARQYSTRLAVLSSSLTHWKKLPPLPSLTSQPHQVLASEPIPFSDLQQVSRIAAYAYSALSQIRVDAKEELVVQFGIP rraga_human Ras-related GTP-binding protein A Adenovirus E3 14.7 kDa-interacting protein 1 FIP-1 RRAGA protein protein human Homo sapiens Human MPNTAMKKKVLLMGKSGSGKTSMRSIIFANYIARDTRRLGATIDVEHSHVRFLGNLVLNLWDCGGQDTFMENYFTSQRDNIFRNVEVLIYVFDVESRELEKDMHYYQSCLEAILQNSPDAKIFCLVHKMDLVQEDQRDLIFKEREEDLRRLSRPLECACFRTSIWDETLYKAWSSIVYQLIPNVQQLEMNLRNFAQIIEADEVLLFERATFLVISHYQCKEQRDVHRFEKISNIIKQFKLSCSKLAASFQSMEVRNSNFAAFIDIFTSNTYVMVVMSDPSIPSAATLINIRNARKHFEKLERVDGPKHSLLMR rragc_human Ras-related GTP-binding protein C GTPase-interacting protein 2 TIB929 RRAGC protein protein human Homo sapiens Human MSLQYGAEETPLAGSYGAADSFPKDFGYGVEEEEEEAAAAGGGVGAGAGGGCGPGGADSSKPRILLMGLRRSGKSSIQKVVFHKMSPNETLFLESTNKIYKDDISNSSFVNFQIWDFPGQMDFFDPTFDYEMIFRGTGALIYVIDAQDDYMEALTRLHITVSKAYKVNPDMNFEVFIHKVDGLSDDHKIETQRDIHQRANDDLADAGLEKLHLSFYLTSIYDHSIFEAFSKVVQKLIPQLPTLENLLNIFISNSGIEKAFLFDVVSKIYIATDSSPVDMQSYELCCDMIDVVIDVSCIYGLKEDGSGSAYDKESMAIIKLNNTTVLYLKEVTKFLALVCILREESFERKGLIDYNFHCFRKAIHEVFEVGVTSHRSCGHQTSASSLKALTHNGTPRNAI robld3-mpks1-1 Interactors of ROBLD3 907767 n/a 907771 unspecified role unspecified role prey prey region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 907772 unspecified role unspecified role prey prey region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 907773 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 907774 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 907775 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig. 2B robld3-mpks1-2 Interactors of ROBLD3 907767 n/a 907771 unspecified role unspecified role prey prey n/a 907772 unspecified role unspecified role prey prey n/a 907776 unspecified role unspecified role prey prey n/a 907775 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 907773 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 907774 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig. 2D rragb-mapksp1-1 Interactors of RRAGB 907767 n/a 907771 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 907772 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 907774 unspecified role unspecified role prey prey n/a 907775 unspecified role unspecified role prey prey n/a 907773 unspecified role unspecified role prey prey association association false false false Fig. 2E rragb-mapksp1-3 Interactors of RRAGB 907767 n/a 907771 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 907773 unspecified role unspecified role prey prey n/a 907774 unspecified role unspecified role prey prey n/a 907775 unspecified role unspecified role prey prey association association false false false Fig. 2I Endogenous Ragulator coimmunoprecipitates with FLAG-RagB independently of amino acid availability and GTP-loading of RagB. rragb-robld3-1 Interactors of RRAGB 907768 n/a 907771 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 907773 unspecified role unspecified role prey prey n/a 907774 unspecified role unspecified role prey prey n/a 907775 unspecified role unspecified role prey prey association association false false false Fig. 2A rragd-robld3-1 Interactors of RRAGD 907768 n/a 907772 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 907774 unspecified role unspecified role prey prey n/a 907773 unspecified role unspecified role prey prey n/a 907775 unspecified role unspecified role prey prey association association false false false Fig. 2A ragc-raga-1 Interaction between RAGA, RAGB and RAGC 907769 n/a 907771 unspecified role unspecified role prey prey n/a 907777 unspecified role unspecified role bait bait n/a 907776 unspecified role unspecified role prey prey association association false false false Fig. 1D rragb-mapksp1-2 Interactors of RRAGB 907769 n/a 907774 unspecified role unspecified role prey prey n/a 907776 unspecified role unspecified role prey prey n/a 907773 unspecified role unspecified role prey prey n/a 907777 unspecified role unspecified role bait bait association association false false false Fig. 2F ragc-c11orf59-1 Colocalisation of RAGC and C11orf59 907770 n/a 907777 unspecified role unspecified role neutral component neutral component n/a 907775 unspecified role unspecified role neutral component neutral component region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false Fig. 2J