MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint artus-2010-2 AIF promotes chromatinolysis and caspase-independent programmed necrosis by interacting with histone H2AX. mouse-embryonic_fibroblast Mus musculus embryonic fibroblasts embryonic_fibroblast Embryonic fibroblast Fibroblasts taken from an embryonic as opposed to a foetal or adult source. Foetus is defined as the stage at which tissue diferentiation is initiated. Tissue taken from an embryonic as opposed to a foetal or adult source. Embryo is defined as the development stage prior to organ formation. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Artus C., Boujrad H., Bouharrour A., Brunelle M.N., Hoos S., Yuste V.J., Lenormand P., Rousselle J.C., Namane A., England P., Lorenzo H.K., Susin S.A. Apoptosis - Interactions involving proteins with a function related to apoptosis The origin of the H2AX recombinant protein and the information about the tAIF tag position were provided by the authors upon email request. santos.susin@crc.jussieu.fr EMBO J. (0261-4189) 2010 Only protein-protein interactions imex curation artus-2010-4 AIF promotes chromatinolysis and caspase-independent programmed necrosis by interacting with histone H2AX. in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Artus C., Boujrad H., Bouharrour A., Brunelle M.N., Hoos S., Yuste V.J., Lenormand P., Rousselle J.C., Namane A., England P., Lorenzo H.K., Susin S.A. Apoptosis - Interactions involving proteins with a function related to apoptosis The origin of the H2AX recombinant protein and the information about the tAIF tag position were provided by the authors upon email request. santos.susin@crc.jussieu.fr EMBO J. (0261-4189) 2010 Only protein-protein interactions imex curation artus-2010-1 AIF promotes chromatinolysis and caspase-independent programmed necrosis by interacting with histone H2AX. mouse-embryonic_fibroblast Mus musculus embryonic fibroblasts embryonic_fibroblast Embryonic fibroblast Fibroblasts taken from an embryonic as opposed to a foetal or adult source. Foetus is defined as the stage at which tissue diferentiation is initiated. Tissue taken from an embryonic as opposed to a foetal or adult source. Embryo is defined as the development stage prior to organ formation. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Artus C., Boujrad H., Bouharrour A., Brunelle M.N., Hoos S., Yuste V.J., Lenormand P., Rousselle J.C., Namane A., England P., Lorenzo H.K., Susin S.A. Apoptosis - Interactions involving proteins with a function related to apoptosis The origin of the H2AX recombinant protein and the information about the tAIF tag position were provided by the authors upon email request. santos.susin@crc.jussieu.fr EMBO J. (0261-4189) 2010 Only protein-protein interactions imex curation artus-2010-3 AIF promotes chromatinolysis and caspase-independent programmed necrosis by interacting with histone H2AX. mouse-embryonic_fibroblast Mus musculus embryonic fibroblasts embryonic_fibroblast Embryonic fibroblast Fibroblasts taken from an embryonic as opposed to a foetal or adult source. Foetus is defined as the stage at which tissue diferentiation is initiated. Tissue taken from an embryonic as opposed to a foetal or adult source. Embryo is defined as the development stage prior to organ formation. confocal microscopy confocal microscopy immunostaining immunostaining Artus C., Boujrad H., Bouharrour A., Brunelle M.N., Hoos S., Yuste V.J., Lenormand P., Rousselle J.C., Namane A., England P., Lorenzo H.K., Susin S.A. Apoptosis - Interactions involving proteins with a function related to apoptosis The origin of the H2AX recombinant protein and the information about the tAIF tag position were provided by the authors upon email request. santos.susin@crc.jussieu.fr EMBO J. (0261-4189) 2010 Only protein-protein interactions imex curation h2ax_mouse Histone H2AX H2ax H2a.x H2afx Hist5-2ax Histone H2A.X protein protein mouse Mus musculus Mouse MSGRGKTGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGHYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKSSATVGPKAPAVGKKASQASQEY aifm1_mouse Apoptosis-inducing factor 1, mitochondrial Programmed cell death protein 8 Aifm1 Aif Pdcd8 protein protein mouse Mus musculus Mouse MFRCGGLAGAFKQKLVPLVRTVYVQRPKQRNRLPGNLFQQWRVPLELQMARQMASSGSSGGKMDNSVLVLIVGLSTIGAGAYAYKTIKEDQKRYNERVMGLGLSPEEKQRRAIASATEGGSVPQIRAPSHVPFLLIGGGTAAFAAARSIRARDPGARVLIVSEDPELPYMRPPLSKELWFSDDPNVTKTLQFRQWNGKERSIYFQPPSFYVSAQDLPNIENGGVAVLTGKKVVHLDVRGNMVKLNDGSQITFEKCLIATGGTPRSLSAIDRAGAEVKSRTTLFRKIGDFRALEKISREVKSITVIGGGFLGSELACALGRKSQASGIEVIQLFPEKGNMGKILPQYLSNWTMEKVKREGVKVMPNAIVQSVGVSGGRLLIKLKDGRKVETDHIVTAVGLEPNVELAKTGGLEIDSDFGGFRVNAELQARSNIWVAGDAACFYDIKLGRRRVEHHDHAVVSGRLAGENMTGAAKPYWHQSMFWSDLGPDVGYEAIGLVDSSLPTVGVFAKATAQDNPKSATEQSGTGIRSESETESEASEITIPPSAPAVPQVPVEGEDYGKGVIFYLRDKVVVGIVLWNVFNRMPIARKIIKDGEQHEDLNEVAKLFNIHED ppia_mouse Peptidyl-prolyl cis-trans isomerase A Ppia Cyclophilin A Cyclosporin A-binding protein SP18 Rotamase A protein protein mouse Mus musculus Mouse MVNPTVFFDITADDEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSSFHRIIPGFMCQGGDFTRHNGTGGRSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITISDCGQL h2ax_human Histone H2AX H2AX H2AFX Histone H2A.X protein protein human Homo sapiens Human MSGRGKTGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGHYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTSATVGPKAPSGGKKATQASQEY q9z0x1-pro_0000022031 Apoptosis-inducing factor 1, mitochondrial Aifm1 Aif Pdcd8 Programmed cell death protein 8 protein protein mouse Mus musculus Mouse GLSPEEKQRRAIASATEGGSVPQIRAPSHVPFLLIGGGTAAFAAARSIRARDPGARVLIVSEDPELPYMRPPLSKELWFSDDPNVTKTLQFRQWNGKERSIYFQPPSFYVSAQDLPNIENGGVAVLTGKKVVHLDVRGNMVKLNDGSQITFEKCLIATGGTPRSLSAIDRAGAEVKSRTTLFRKIGDFRALEKISREVKSITVIGGGFLGSELACALGRKSQASGIEVIQLFPEKGNMGKILPQYLSNWTMEKVKREGVKVMPNAIVQSVGVSGGRLLIKLKDGRKVETDHIVTAVGLEPNVELAKTGGLEIDSDFGGFRVNAELQARSNIWVAGDAACFYDIKLGRRRVEHHDHAVVSGRLAGENMTGAAKPYWHQSMFWSDLGPDVGYEAIGLVDSSLPTVGVFAKATAQDNPKSATEQSGTGIRSESETESEASEITIPPSAPAVPQVPVEGEDYGKGVIFYLRDKVVVGIVLWNVFNRMPIARKIIKDGEQHEDLNEVAKLFNIHED 102 612 h2afx-aifm1-1 916862 n/a 916866 unspecified role unspecified role bait bait n/a 916867 unspecified role unspecified role prey prey physical association physical association false false false 1c and S8 left Treatment with MNNG (induces cell death via DNA damage) is required for the interaction to happen. ppia-aifm1 916862 n/a 916868 unspecified role unspecified role bait bait purified purified n/a 916867 unspecified role unspecified role prey prey physical association physical association false false false S8 right Treatment with MNNG (induces cell death via DNA damage) is required for the interaction to happen. The presence of H2AX is also required, as shown by the absence of interaction in H2AX -/- nuclei. aifm1-h2afx-3 916863 n/a 916869 unspecified role unspecified role prey prey purified purified n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) n/a 916870 unspecified role unspecified role bait bait purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false 916863 916863 916863 2a Dissociation of the tAIF/H2AX complex shows two phases, one slow and one fast. aifm1-h2afx-5 916863 n/a 916869 unspecified role unspecified role prey prey purified purified n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false in vitro In vitro n/a 916867 competitor competitor competitor neutral component neutral component purified purified proline-rich binding domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Q9Z0X1:p.[Pro543Ala;Pro544Ala;Pro547Ala;Pro550Ala;Pro553Ala] mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) n/a 916870 unspecified role unspecified role bait bait purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false 2b aifm1-h2afx-1 916864 n/a 916866 unspecified role unspecified role prey prey n/a 916867 unspecified role unspecified role bait bait flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 1b Treatment with MNNG (induces cell death via DNA damage) is required for the interaction to happen. aifm1-h2afx-7 916865 n/a 916866 unspecified role unspecified role neutral component neutral component n/a 916867 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false 1d Treatment with MNNG (induces cell death via DNA damage) is required for the interaction to happen.