IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ ninios-2010-1 Histone H1 subtype preferences of DFF40 and possible nuclear localization of DFF40/45 in normal and trichostatin A-treated NB4 leukemic cells. human-nb4 Human NB4 APL cell line nb4 NB4 human acute promyelocytic leukemia cells Human acute promyelocytic leukemia established from the bone marrow of a 23- year-old woman with acute promyelocytic leukemia (APL = AML FAB M3) in second relapse in 1989; patented cell line; cells carry the t(15;17) PML-RARA fusion gene confirmed as human with IEF of AST, MDH anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Ninios Y.P., Sekeri-Pataryas K.E., Sourlingas T.G. Apoptosis - Interactions involving proteins with a function related to apoptosis The purified nuclear chromatin fraction of NP4 cells was used to perform the coip here. The samples were treated with cross-linking agent formaldehyde before the coip was performed. sourlin@bio.demokritos.gr Apoptosis (1360-8185) 2010 Only protein-protein interactions imex curation ninios-2010-2 Histone H1 subtype preferences of DFF40 and possible nuclear localization of DFF40/45 in normal and trichostatin A-treated NB4 leukemic cells. human-nb4 Human NB4 APL cell line nb4 NB4 human acute promyelocytic leukemia cells Human acute promyelocytic leukemia established from the bone marrow of a 23- year-old woman with acute promyelocytic leukemia (APL = AML FAB M3) in second relapse in 1989; patented cell line; cells carry the t(15;17) PML-RARA fusion gene confirmed as human with IEF of AST, MDH anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Ninios Y.P., Sekeri-Pataryas K.E., Sourlingas T.G. Apoptosis - Interactions involving proteins with a function related to apoptosis The purified nuclear chromatin fraction of NP4 cells was used to perform the coip here. The samples were treated with cross-linking agent formaldehyde before the coip was performed. sourlin@bio.demokritos.gr Apoptosis (1360-8185) 2010 Only protein-protein interactions imex curation dffb_human DNA fragmentation factor subunit beta DNA fragmentation factor 40 kDa subunit Caspase-activated deoxyribonuclease DFFB CAD DFF2 DFF40 Caspase-activated nuclease protein protein human Homo sapiens Human MLQKPKSVKLRALRSPRKFGVAGRSCQEVLRKGCLRFQLPERGSRLCLYEDGTELTEDYFPSVPDNAELVLLTLGQAWQGYVSDIRRFLSAFHEPQVGLIQAAQQLLCDEQAPQRQRLLADLLHNVSQNIAAETRAEDPPWFEGLESRFQSKSGYLRYSCESRIRSYLREVSSYPSTVGAEAQEEFLRVLGSMCQRLRSMQYNGSYFDRGAKGGSRLCTPEGWFSCQGPFDMDSCLSRHSINPYSNRESRILFSTWNLDHIIEKKRTIIPTLVEAIKEQDGREVDWEYFYGLLFTSENLKLVHIVCHKKTTHKLNCDPSRIYKPQTRLKRKQPVRKRQ dffa_human DNA fragmentation factor subunit alpha DNA fragmentation factor 45 kDa subunit Inhibitor of CAD DFFA DFF1 DFF45 H13 protein protein human Homo sapiens Human MEVTGDAGVPESGEIRTLKPCLLRRNYSREQHGVAASCLEDLRSKACDILAIDKSLTPVTLVLAEDGTIVDDDDYFLCLPSNTKFVALASNEKWAYNNSDGGTAWISQESFDVDETDSGAGLKWKNVARQLKEDLSSIILLSEEDLQMLVDAPCSDLAQELRQSCATVQRLQHTLQQVLDQREEVRQSKQLLQLYLQALEKEGSLLSKQEESKAAFGEEVDAVDTGISRETSSDVALASHILTALREKQAPELSLSSQDLELVTKEDPKALAVALNWDIKKTETVQEACERELALRLQQTQSLHSLRSISASKASPPGDLQNPKRARQDPT h11_human Histone H1.1 H1-1 H1F1 HIST1H1A Histone H1a protein protein human Homo sapiens Human MSETVPPAPAASAAPEKPLAGKKAKKPAKAAAASKKKPAGPSVSELIVQAASSSKERGGVSLAALKKALAAAGYDVEKNNSRIKLGIKSLVSKGTLVQTKGTGASGSFKLNKKASSVETKPGASKVATKTKATGASKKLKKATGASKKSVKTPKKAKKPAATRKSSKNPKKPKTVKPKKVAKSPAKAKAVKPKAAKARVTKPKTAKPKKAAPKKK h10_human Histone H1.0 H1-0 H1F0 H1FV Histone H1' Histone H1(0) protein protein human Homo sapiens Human MTENSTSAPAAKPKRAKASKKSTDHPKYSDMIVAAIQAEKNRAGSSRQSIQKYIKSHYKVGENADSQIKLSIKRLVTTGVLKQTKGVGASGSFRLAKSDEPKKSVAFKKTKKEIKKVATPKKASKPKKAASKAPTKKPKATPVKKAKKKLAATPKKAKKPKTVKAKPVKASKPKKAKPVKPKAKSSAKRAGKKK h15_human Histone H1.5 H1-5 H1F5 HIST1H1B Histone H1a Histone H1b Histone H1s-3 protein protein human Homo sapiens Human MSETAPAETATPAPVEKSPAKKKATKKAAGAGAAKRKATGPPVSELITKAVAASKERNGLSLAALKKALAAGGYDVEKNNSRIKLGLKSLVSKGTLVQTKGTGASGSFKLNKKAASGEAKPKAKKAGAAKAKKPAGATPKKAKKAAGAKKAVKKTPKKAKKPAAAGVKKVAKSPKKAKAAAKPKKATKSPAKPKAVKPKAAKPKAAKPKAAKPKAAKAKKAAAKKK h13_human Histone H1.3 H1-3 H1F3 HIST1H1D Histone H1c Histone H1s-2 protein protein human Homo sapiens Human MSETAPLAPTIPAPAEKTPVKKKAKKAGATAGKRKASGPPVSELITKAVAASKERSGVSLAALKKALAAAGYDVEKNNSRIKLGLKSLVSKGTLVQTKGTGASGSFKLNKKAASGEGKPKAKKAGAAKPRKPAGAAKKPKKVAGAATPKKSIKKTPKKVKKPATAAGTKKVAKSAKKVKTPQPKKAAKSPAKAKAPKPKAAKPKSGKPKVTKAKKAAPKKK dffb-dffa 1253989 n/a 1253991 unspecified role unspecified role bait bait n/a 1253992 unspecified role unspecified role prey prey physical association physical association false false false 4b The interaction decreases upon TSA treatment (induces apoptosis). Histone H1 was also identified in this complex but could not be ascribed to a single gene product. dffb-h1 1253990 n/a 1253993 unspecified role unspecified role prey prey n/a 1253994 unspecified role unspecified role prey prey n/a 1253995 unspecified role unspecified role prey prey n/a 1253996 unspecified role unspecified role prey prey n/a 1253991 unspecified role unspecified role bait bait association association false false false 6a and 7b The interaction decreases upon TSA treatment (induces apoptosis).