IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ mamidipudi-2009-1 A novel pro-apoptotic function of RACK1: suppression of Src activity in the intrinsic and Akt pathways. human-ht_29 Homo sapiens HT-29 caucasian women with colon adenocarcinoma ht_29 HT-29 confirmed as human with IEF of AST, LDH established from the primary tumor of a 44-year-old Caucasian woman with colon adenocarcinoma in 1964; described to be heterotransplantable forming well-differentiated grade I tumors anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Mamidipudi V., Cartwright C.A. Apoptosis - Interactions involving proteins with a function related to apoptosis The experiment was performed using cytisolic fractions of HT-29 cells. chris.cartwright@stanford.edu Oncogene (0950-9232) 2009 Only protein-protein interactions imex curation mamidipudi-2009-2 A novel pro-apoptotic function of RACK1: suppression of Src activity in the intrinsic and Akt pathways. human-ht_29 Homo sapiens HT-29 caucasian women with colon adenocarcinoma ht_29 HT-29 confirmed as human with IEF of AST, LDH established from the primary tumor of a 44-year-old Caucasian woman with colon adenocarcinoma in 1964; described to be heterotransplantable forming well-differentiated grade I tumors crosslink cross-linking study crosslink western blot western blot Immuno blot Immuno blot Mamidipudi V., Cartwright C.A. Apoptosis - Interactions involving proteins with a function related to apoptosis The experiment was performed using cytisolic fractions of HT-29 cells. chris.cartwright@stanford.edu Oncogene (0950-9232) 2009 Only protein-protein interactions imex curation bax_human Apoptosis regulator BAX BAX BCL2L4 Bcl-2-like protein 4 protein protein human Homo sapiens Human MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGTPTWQTVTIFVAGVLTASLTIWKKMG bax-1 1189119 n/a 1189121 unspecified role unspecified role neutral component neutral component Stoichiometry: 2.0 physical association physical association false false false 4a Transfection of RACK1 within the cells was required for the formation of this dimer of Bax. bax-1 1189119 n/a 1189121 unspecified role unspecified role neutral component neutral component Stoichiometry: 3.0 physical association physical association false false false 4a Transfection of RACK1 within the cells increased the formation of this trimer of Bax. bax-1 1189120 n/a 1189121 unspecified role unspecified role neutral component neutral component Stoichiometry: 2.0 physical association physical association false false false 4b Transfection of RACK1 and the presence of Bim within the cells was required for the formation of this dimer of Bax. bax-1 1189120 n/a 1189121 unspecified role unspecified role neutral component neutral component Stoichiometry: 3.0 physical association physical association false false false 4b Transfection of RACK1 and the presence of Bim within the cells was required for the formation of this trimer of Bax.