IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ burikhanov-2009-5 The tumor suppressor Par-4 activates an extrinsic pathway for apoptosis. human-pc3 Human PC3 Caucasian prostate adenocarcinoma pc3 Human Caucasian prostate adenocarcinoma confocal microscopy confocal microscopy immunostaining immunostaining Burikhanov R., Zhao Y., Goswami A., Qiu S., Schwarze SR., Rangnekar VM. Apoptosis - Interactions involving proteins with a function related to apoptosis vmrang01@email.uky.edu Cell (0092-8674) 2009 Only protein-protein interactions 14 imex curation burikhanov-2009-1 The tumor suppressor Par-4 activates an extrinsic pathway for apoptosis. human-pc3 Human PC3 Caucasian prostate adenocarcinoma pc3 Human Caucasian prostate adenocarcinoma anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Burikhanov R., Zhao Y., Goswami A., Qiu S., Schwarze SR., Rangnekar VM. Apoptosis - Interactions involving proteins with a function related to apoptosis vmrang01@email.uky.edu Cell (0092-8674) 2009 Only protein-protein interactions 14 imex curation burikhanov-2009-3 The tumor suppressor Par-4 activates an extrinsic pathway for apoptosis. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Burikhanov R., Zhao Y., Goswami A., Qiu S., Schwarze SR., Rangnekar VM. Apoptosis - Interactions involving proteins with a function related to apoptosis Cell surface proteins were biotinylated using cell-impermeable sulfo-NHS-LC-biotin. Participants were identified by anti-bait, anti-tag and avidin-HRP blots. vmrang01@email.uky.edu Cell (0092-8674) 2009 Only protein-protein interactions 14 imex curation burikhanov-2009-4 The tumor suppressor Par-4 activates an extrinsic pathway for apoptosis. in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Burikhanov R., Zhao Y., Goswami A., Qiu S., Schwarze SR., Rangnekar VM. Apoptosis - Interactions involving proteins with a function related to apoptosis Cell were pre-treated with TRAIL. Cell surface proteins were biotinylated using cell-impermeable sulfo-NHS-LC-biotin. Participants were identified by anti-bait, anti-tag and avidin-HRP blots. vmrang01@email.uky.edu Cell (0092-8674) 2009 Only protein-protein interactions 14 imex curation burikhanov-2009-2 The tumor suppressor Par-4 activates an extrinsic pathway for apoptosis. human-pc3 Human PC3 Caucasian prostate adenocarcinoma pc3 Human Caucasian prostate adenocarcinoma anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Burikhanov R., Zhao Y., Goswami A., Qiu S., Schwarze SR., Rangnekar VM. Apoptosis - Interactions involving proteins with a function related to apoptosis vmrang01@email.uky.edu Cell (0092-8674) 2009 Only protein-protein interactions 14 imex curation burikhanov-2009-6 The tumor suppressor Par-4 activates an extrinsic pathway for apoptosis. human-bph1 Human BPH1 cells bph1 BPH-1 benign hyperplastic prostatic epithelial cells fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining Burikhanov R., Zhao Y., Goswami A., Qiu S., Schwarze SR., Rangnekar VM. Apoptosis - Interactions involving proteins with a function related to apoptosis vmrang01@email.uky.edu Cell (0092-8674) 2009 Only protein-protein interactions 14 imex curation burikhanov-2009-7 The tumor suppressor Par-4 activates an extrinsic pathway for apoptosis. human-pc3 Human PC3 Caucasian prostate adenocarcinoma pc3 Human Caucasian prostate adenocarcinoma pull down pull down de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence Burikhanov R., Zhao Y., Goswami A., Qiu S., Schwarze SR., Rangnekar VM. Apoptosis - Interactions involving proteins with a function related to apoptosis vmrang01@email.uky.edu Cell (0092-8674) 2009 Only protein-protein interactions 14 imex curation burikhanov-2009-8 The tumor suppressor Par-4 activates an extrinsic pathway for apoptosis. human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Burikhanov R., Zhao Y., Goswami A., Qiu S., Schwarze SR., Rangnekar VM. Apoptosis - Interactions involving proteins with a function related to apoptosis vmrang01@email.uky.edu Cell (0092-8674) 2009 Only protein-protein interactions 14 imex curation burikhanov-2009-9 The tumor suppressor Par-4 activates an extrinsic pathway for apoptosis. human-h460 Homo sapiens non-small-cell lung cancer cell line H460 h460 human non-small-cell lung cancer cell line H460 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Burikhanov R., Zhao Y., Goswami A., Qiu S., Schwarze SR., Rangnekar VM. Apoptosis - Interactions involving proteins with a function related to apoptosis vmrang01@email.uky.edu Cell (0092-8674) 2009 Only protein-protein interactions 14 imex curation pawr_human PRKC apoptosis WT1 regulator protein Prostate apoptosis response 4 protein PAWR PAR4 protein protein human Homo sapiens Human MATGGYRTSSGLGGSTTDFLEEWKAKREKMRAKQNPPGPAPPGGGSSDAAGKPPAGALGTPAAAAANELNNNLPGGAPAAPAVPGPGGVNCAVGSAMLTRAAPGPRRSEDEPPAASASAAPPPQRDEEEPDGVPEKGKSSGPSARKGKGQIEKRKLREKRRSTGVVNIPAAECLDEYEDDEAGQKERKREDAITQQNTIQNEAVNLLDPGSSYLLQEPPRTVSGRYKSTTSVSEEDVSSRYSRTDRSGFPRYNRDANVSGTLVSSSTLEKKIEDLEKEVVRERQENLRLVRLMQDKEEMIGKLKEEIDLLNRDLDDIEDENEQLKQENKTLLKVVGQLTR bip_human Endoplasmic reticulum chaperone BiP HSPA5 GRP78 Immunoglobulin heavy chain-binding protein 78 kDa glucose-regulated protein Binding-immunoglobulin protein Heat shock protein 70 family protein 5 Heat shock protein family A member 5 protein protein human Homo sapiens Human MKLSLVAAMLLLLSAARAEEEDKKEDVGTVVGIDLGTTYSCVGVFKNGRVEIIANDQGNRITPSYVAFTPEGERLIGDAAKNQLTSNPENTVFDAKRLIGRTWNDPSVQQDIKFLPFKVVEKKTKPYIQVDIGGGQTKTFAPEEISAMVLTKMKETAEAYLGKKVTHAVVTVPAYFNDAQRQATKDAGTIAGLNVMRIINEPTAAAIAYGLDKREGEKNILVFDLGGGTFDVSLLTIDNGVFEVVATNGDTHLGGEDFDQRVMEHFIKLYKKKTGKDVRKDNRAVQKLRREVEKAKRALSSQHQARIEIESFYEGEDFSETLTRAKFEELNMDLFRSTMKPVQKVLEDSDLKKSDIDEIVLVGGSTRIPKIQQLVKEFFNGKEPSRGINPDEAVAYGAAVQAGVLSGDQDTGDLVLLDVCPLTLGIETVGGVMTKLIPRNTVVPTKKSQIFSTASDNQPTVTIKVYEGERPLTKDNHLLGTFDLTGIPPAPRGVPQIEVTFEIDVNGILRVTAEDKGTGNKNKITITNDQNRLTPEEIERMVNDAEKFAEEDKKLKERIDTRNELESYAYSLKNQIGDKEKLGGKLSSEDKETMEKAVEEKIEWLESHQDADIEDFKAKKKELEEIVQPIISKLYGSAGPPPTGEEDTAEKDEL casp8_human Caspase-8 CASP8 MCH5 ICE-like apoptotic protease 5 MORT1-associated ced-3 homolog FADD-homologous ICE/ced-3-like protease FADD-like ICE Apoptotic cysteine protease Apoptotic protease Mch-5 CAP4 protein protein human Homo sapiens Human MDFSRNLYDIGEQLDSEDLASLKFLSLDYIPQRKQEPIKDALMLFQRLQEKRMLEESNLSFLKELLFRINRLDLLITYLNTRKEEMERELQTPGRAQISAYRVMLYQISEEVSRSELRSFKFLLQEEISKCKLDDDMNLLDIFIEMEKRVILGEGKLDILKRVCAQINKSLLKIINDYEEFSKERSSSLEGSPDEFSNGEELCGVMTISDSPREQDSESQTLDKVYQMKSKPRGYCLIINNHNFAKAREKVPKLHSIRDRNGTHLDAGALTTTFEELHFEIKPHDDCTVEQIYEILKIYQLMDHSNMDCFICCILSHGDKGIIYGTDGQEAPIYELTSQFTGLKCPSLAGKPKVFFIQACQGDNYQKGIPVETDSEEQPYLEMDLSSPQTRYIPDEADFLLGMATVNNCVSYRNPAEGTWYIQSLCQSLRERCPRGDDILTILTEVNYEVSNKDDKKNMGKQMPQPTFTLRKKLVFPSD cav1_human Caveolin-1 CAV1 CAV protein protein human Homo sapiens Human MSGGKYVDSEGHLYTVPIREQGNIYKPNNKAMADELSEKQVYDAHTKEIDLVNRDPKHLNDDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLSALFGIPMALIWGIYFAILSFLHIWAVVPCIKSFLIEIQCISRVYSIYVHTVCDPLFEAVGKIFSNVRINLQKEI pawr_rat PRKC apoptosis WT1 regulator protein Prostate apoptosis response 4 protein Transcriptional repressor Par-4-like protein PAWR Pawr Par4 protein protein rat Rattus norvegicus (Rat) Rat MATGGYRSSGSTTDFLEEWKAKREKMRAKQNPVGPGSSGGDPAAKSPAGPLAQTTAAGTSELNHGPAGAAAPAAPGPGALNCAHGSSALPRGAPGSRRPEDECPIAAGAAGAPASRGDEEEPDSAPEKGRSSGPSARKGKGQIEKRKLREKRRSTGVVNIPAAECLDEYEDDEAGQKERKREDAITQQNTIQNEAASLPDPGTSYLPQDPSRTVPGRYKSTISAPEEEILNRYPRTDRSGFSRHNRDTSAPANFASSSTLEKRIEDLEKEVLRERQENLRLTRLMQDKEEMIGKLKEEIDLLNRDLDDMEDENEQLKQENKTLLKVVGQLTR top1_human DNA topoisomerase 1 DNA topoisomerase I TOP1 protein protein human Homo sapiens Human MSGDHLHNDSQIEADFRLNDSHKHKDKHKDREHRHKEHKKEKDREKSKHSNSEHKDSEKKHKEKEKTKHKDGSSEKHKDKHKDRDKEKRKEEKVRASGDAKIKKEKENGFSSPPQIKDEPEDDGYFVPPKEDIKPLKRPRDEDDADYKPKKIKTEDTKKEKKRKLEEEEDGKLKKPKNKDKDKKVPEPDNKKKKPKKEEEQKWKWWEEERYPEGIKWKFLEHKGPVFAPPYEPLPENVKFYYDGKVMKLSPKAEEVATFFAKMLDHEYTTKEIFRKNFFKDWRKEMTNEEKNIITNLSKCDFTQMSQYFKAQTEARKQMSKEEKLKIKEENEKLLKEYGFCIMDNHKERIANFKIEPPGLFRGRGNHPKMGMLKRRIMPEDIIINCSKDAKVPSPPPGHKWKEVRHDNKVTWLVSWTENIQGSIKYIMLNPSSRIKGEKDWQKYETARRLKKCVDKIRNQYREDWKSKEMKVRQRAVALYFIDKLALRAGNEKEEGETADTVGCCSLRVEHINLHPELDGQEYVVEFDFLGKDSIRYYNKVPVEKRVFKNLQLFMENKQPEDDLFDRLNTGILNKHLQDLMEGLTAKVFRTYNASITLQQQLKELTAPDENIPAKILSYNRANRAVAILCNHQRAPPKTFEKSMMNLQTKIDAKKEQLADARRDLKSAKADAKVMKDAKTKKVVESKKKAVQRLEEQLMKLEVQATDREENKQIALGTSKLNYLDPRITVAWCKKWGVPIEKIYNKTQREKFAWAIDMADEDYEF pawr-hspa5-7 Colocalisation of PAWR (PAR4) and HSPA5 (GRP78) 838346 n/a 838355 unspecified role unspecified role neutral component neutral component n/a 838356 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false Figs. 3E, Supp. Figs. 3C, 3E Upon treatment with TRAIL, Par-4 colocalized with GRP78 at the plasma membrane. casp8-hspa5-1 Colocalisation of CASP8 and HSPA5 (GRP78) 838346 n/a 838357 unspecified role unspecified role neutral component neutral component n/a 838356 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false Supp. Fig. 8D TRAIL + PAR4 cav1-hspa5-1 Colocalisation of CAV1 and HSPA5 (GRP78) 838346 n/a 838358 unspecified role unspecified role neutral component neutral component n/a 838356 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false Supp. Fig. 9 TRAIL + PAR4 pawr-hspa5-1 Interaction between PAWR (PAR4) and HSPA5 (GRP78) demonstrated by coimmunopreciptiation 838347 n/a 838356 unspecified role unspecified role prey prey n-terminal required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false n/a 838355 unspecified role unspecified role bait bait physical association physical association false false false Figs. 3A, 3B, Supp. Fig. 3F, Supp. Fig. 7C When cells are pre-treated with TRAIL, the interaction is enriched in the membrane fraction. pawr-hspa5-2 Interaction between PAWR (PAR4) and HSPA5 (GRP78) demonstrated by coimmunopreciptiation 838347 n/a 838355 unspecified role unspecified role prey prey n/a 838356 unspecified role unspecified role bait bait physical association physical association false false false Fig. 3A, Supp. Fig. 3F When cells are pre-treated with TRAIL, the interaction is enriched in the membrane fraction. pawr-hspa5-4 Interaction between PAWR (PAR4) and HSPA5 (GRP78) demonstrated by pulldown 838348 n/a 838359 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region Thioredoxin fusion fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) n/a 838356 unspecified role unspecified role prey prey region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-pc3 Human PC3 Caucasian prostate adenocarcinoma pc3 Human Caucasian prostate adenocarcinoma physical association physical association false false false Figs. 3D Labelling with cell-impermeable sulfo-NHS-LC-biotin and then performing an avidinn-HRP blot, indicated proteins were interacting at the cell surface. pawr-hspa5-10 Interaction between PAWR (PAR4) and HSPA5 (GRP78) demonstrated by pulldown 838348 n/a 838356 unspecified role unspecified role prey prey n/a 838359 unspecified role unspecified role bait bait sac region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Supp. Fig. 2B pawr-hspa5-5 Interaction between PAWR (PAR4) and HSPA5 (GRP78) demonstrated by pulldown 838349 n/a 838355 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) n/a 838356 unspecified role unspecified role prey prey region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-pc3 Human PC3 Caucasian prostate adenocarcinoma pc3 Human Caucasian prostate adenocarcinoma physical association physical association false false false Figs. 3D Labelling with cell-impermeable sulfo-NHS-LC-biotin and then performing an avidinn-HRP blot, indicated proteins were interacting at the cell surface. pawr-hspa5-6 Interaction between PAWR (PAR4) and HSPA5 (GRP78) demonstrated by pulldown 838349 n/a 838356 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-pc3 Human PC3 Caucasian prostate adenocarcinoma pc3 Human Caucasian prostate adenocarcinoma n/a 838355 unspecified role unspecified role prey prey region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) physical association physical association false false false Figs. 3D Labelling with cell-impermeable sulfo-NHS-LC-biotin and then performing an avidinn-HRP blot, indicated proteins were interacting at the cell surface. pawr-hspa5-3 Interaction between PAWR (PAR4) and HSPA5 (GRP78) demonstrated by coimmunopreciptiation 838350 n/a 838359 unspecified role unspecified role bait bait sac region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 838356 unspecified role unspecified role prey prey physical association physical association false false false Fig. 3B pawr-hspa5-8 Colocalisation of PAWR (PAR4) and HSPA5 (GRP78) 838351 n/a 838356 unspecified role unspecified role neutral component neutral component n/a 838355 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false Figs. 3E, Supp. Figs. 3C, 3E pawr-hspa5-9 Interaction between PAWR (PAR4), TOP1 and HSPA5 (GRP78) demonstrated by pulldown 838352 n/a 838356 unspecified role unspecified role prey prey human-pc3 Human PC3 Caucasian prostate adenocarcinoma pc3 Human Caucasian prostate adenocarcinoma n/a 838360 unspecified role unspecified role prey prey n/a 838359 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) association association false false false Supp. Figs. 2A, 2C, Supp. Table 1 pawr-hspa5-11 Interaction between PAWR (PAR4) and HSPA5 (GRP78) demonstrated by coimmunopreciptiation 838353 n/a 838355 unspecified role unspecified role bait bait n/a 838356 unspecified role unspecified role prey prey physical association physical association false false false Supp. Fig. 11 pawr-hspa5-12 Interaction between PAWR (PAR4) and HSPA5 (GRP78) demonstrated by coimmunopreciptiation 838354 n/a 838356 unspecified role unspecified role prey prey n/a 838355 unspecified role unspecified role bait bait physical association physical association false false false Supp. Fig. 11