IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ kaneko-2009-4 Assembly pathway of the Mammalian proteasome base subcomplex is mediated by multiple specific chaperones. in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Kaneko T., Hamazaki J., Iemura S., Sasaki K., Furuyama K., Natsume T., Tanaka K., Murata S. Apoptosis - Interactions involving proteins with a function related to apoptosis Additional details on clones and expression method supplied by author. Extracts were fractionated by 4%-24% glycerol gradient centrifugation. followed by immunoprecipitation with M2 agarose. Proteins named for yeast homologues so identities confirmed by alignment. Rpt1=P35998, Rpt2=P62191, Rpt3=P43686, Rpt4=P62333, Rpt5=P17980, Rpt6=P62196, Rpn1=Q13200, Rpn2=Q99460, Rpn3=O43242, Rpn5=O00232, Rpn6=O00232, Rpn7=Q15008, Rpn8=P51665, Rpn9=Q9UNM6, Rpn10=P55036, Rpn11=O00487, Rpn12=P48556, Rpn13=Q16186, Rpn14=A6NDR5, A1=P60900, a2=P25787, a3=P25789, a4=O14818, a5=P28066, a6=P25786, a7=P25788, b1=P28072, b2=Q99436, b3=P49720, b4=P49721, b5=P28074, b6=P20618, b7=P28070 smurata@mol.f.u-tokyo.ac.jp Cell (0092-8674) 2009 Only protein-protein interactions 35 imex curation kaneko-2009-3 Assembly pathway of the Mammalian proteasome base subcomplex is mediated by multiple specific chaperones. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Kaneko T., Hamazaki J., Iemura S., Sasaki K., Furuyama K., Natsume T., Tanaka K., Murata S. Apoptosis - Interactions involving proteins with a function related to apoptosis Extracts were fractionated by 4%-24% glycerol gradient centrifugation. followed by immunoprecipitation with M2 agarose. Proteins named for yeast homologues so identities confirmed by alignment. Rpt1=P35998, Rpt2=P62191, Rpt3=P43686, Rpt4=P62333, Rpt5=P17980, Rpt6=P62196, Rpn1=Q13200, Rpn2=Q99460, Rpn3=O43242, Rpn5=O00232, Rpn6=O00232, Rpn7=Q15008, Rpn8=P51665, Rpn9=Q9UNM6, Rpn10=P55036, Rpn11=O00487, Rpn12=P48556, Rpn13=Q16186, Rpn14=A6NDR5, A1=P60900, a2=P25787, a3=P25789, a4=O14818, a5=P28066, a6=P25786, a7=P25788, b1=P28072, b2=Q99436, b3=P49720, b4=P49721, b5=P28074, b6=P20618, b7=P28070 smurata@mol.f.u-tokyo.ac.jp Cell (0092-8674) 2009 Only protein-protein interactions 35 imex curation kaneko-2009-1 Assembly pathway of the Mammalian proteasome base subcomplex is mediated by multiple specific chaperones. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence Kaneko T., Hamazaki J., Iemura S., Sasaki K., Furuyama K., Natsume T., Tanaka K., Murata S. Apoptosis - Interactions involving proteins with a function related to apoptosis Extracts were fractionated by 4%-24% glycerol gradient centrifugation. followed by immunoprecipitation with M2 agarose. Proteins named for yeast homologues so identities confirmed by alignment. Rpt1=P35998, Rpt2=P62191, Rpt3=P43686, Rpt4=P62333, Rpt5=P17980, Rpt6=P62196, Rpn1=Q13200, Rpn2=Q99460, Rpn3=O43242, Rpn5=O00232, Rpn6=O00232, Rpn7=Q15008, Rpn8=P51665, Rpn9=Q9UNM6, Rpn10=P55036, Rpn11=O00487, Rpn12=P48556, Rpn13=Q16186, Rpn14=A6NDR5, A1=P60900, a2=P25787, a3=P25789, a4=O14818, a5=P28066, a6=P25786, a7=P25788, b1=P28072, b2=Q99436, b3=P49720, b4=P49721, b5=P28074, b6=P20618, b7=P28070 smurata@mol.f.u-tokyo.ac.jp Cell (0092-8674) 2009 Only protein-protein interactions 35 imex curation kaneko-2009-6 Assembly pathway of the Mammalian proteasome base subcomplex is mediated by multiple specific chaperones. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Kaneko T., Hamazaki J., Iemura S., Sasaki K., Furuyama K., Natsume T., Tanaka K., Murata S. Apoptosis - Interactions involving proteins with a function related to apoptosis Extracts were fractionated by 4%-24% glycerol gradient centrifugation. followed by immunoprecipitation with M2 agarose. Proteins named for yeast homologues so identities confirmed by alignment. Rpt1=P35998, Rpt2=P62191, Rpt3=P43686, Rpt4=P62333, Rpt5=P17980, Rpt6=P62196, Rpn1=Q13200, Rpn2=Q99460, Rpn3=O43242, Rpn5=O00232, Rpn6=O00232, Rpn7=Q15008, Rpn8=P51665, Rpn9=Q9UNM6, Rpn10=P55036, Rpn11=O00487, Rpn12=P48556, Rpn13=Q16186, Rpn14=A6NDR5, A1=P60900, a2=P25787, a3=P25789, a4=O14818, a5=P28066, a6=P25786, a7=P25788, b1=P28072, b2=Q99436, b3=P49720, b4=P49721, b5=P28074, b6=P20618, b7=P28070 smurata@mol.f.u-tokyo.ac.jp Cell (0092-8674) 2009 Only protein-protein interactions 35 imex curation kaneko-2009-5 Assembly pathway of the Mammalian proteasome base subcomplex is mediated by multiple specific chaperones. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. solution sedimentati cosedimentation in solution solution sedimentati western blot western blot Immuno blot Immuno blot Kaneko T., Hamazaki J., Iemura S., Sasaki K., Furuyama K., Natsume T., Tanaka K., Murata S. Apoptosis - Interactions involving proteins with a function related to apoptosis Extracts were fractionated by 4%-24% glycerol gradient centrifugation. followed by immunoprecipitation with M2 agarose. Proteins named for yeast homologues so identities confirmed by alignment. Rpt1=P35998, Rpt2=P62191, Rpt3=P43686, Rpt4=P62333, Rpt5=P17980, Rpt6=P62196, Rpn1=Q13200, Rpn2=Q99460, Rpn3=O43242, Rpn5=O00232, Rpn6=O00232, Rpn7=Q15008, Rpn8=P51665, Rpn9=Q9UNM6, Rpn10=P55036, Rpn11=O00487, Rpn12=P48556, Rpn13=Q16186, Rpn14=A6NDR5, A1=P60900, a2=P25787, a3=P25789, a4=O14818, a5=P28066, a6=P25786, a7=P25788, b1=P28072, b2=Q99436, b3=P49720, b4=P49721, b5=P28074, b6=P20618, b7=P28070 smurata@mol.f.u-tokyo.ac.jp Cell (0092-8674) 2009 Only protein-protein interactions 35 imex curation kaneko-2009-2 Assembly pathway of the Mammalian proteasome base subcomplex is mediated by multiple specific chaperones. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. solution sedimentati cosedimentation in solution solution sedimentati western blot western blot Immuno blot Immuno blot Kaneko T., Hamazaki J., Iemura S., Sasaki K., Furuyama K., Natsume T., Tanaka K., Murata S. Apoptosis - Interactions involving proteins with a function related to apoptosis Extracts were fractionated by 4%-24% glycerol gradient centrifugation. followed by immunoprecipitation with M2 agarose. Proteins named for yeast homologues so identities confirmed by alignment. Rpt1=P35998, Rpt2=P62191, Rpt3=P43686, Rpt4=P62333, Rpt5=P17980, Rpt6=P62196, Rpn1=Q13200, Rpn2=Q99460, Rpn3=O43242, Rpn5=O00232, Rpn6=O00232, Rpn7=Q15008, Rpn8=P51665, Rpn9=Q9UNM6, Rpn10=P55036, Rpn11=O00487, Rpn12=P48556, Rpn13=Q16186, Rpn14=A6NDR5, A1=P60900, a2=P25787, a3=P25789, a4=O14818, a5=P28066, a6=P25786, a7=P25788, b1=P28072, b2=Q99436, b3=P49720, b4=P49721, b5=P28074, b6=P20618, b7=P28070 smurata@mol.f.u-tokyo.ac.jp Cell (0092-8674) 2009 Only protein-protein interactions 35 imex curation prs6b_human 26S proteasome regulatory subunit 6B Proteasome 26S subunit ATPase 4 MB67-interacting protein PSMC4 TBP7 MIP224 Tat-binding protein 7 26S proteasome AAA-ATPase subunit RPT3 protein protein human Homo sapiens Human MEEIGILVEKAQDEIPALSVSRPQTGLSFLGPEPEDLEDLYSRYKKLQQELEFLEVQEEYIKDEQKNLKKEFLHAQEEVKRIQSIPLVIGQFLEAVDQNTAIVGSTTGSNYYVRILSTIDRELLKPNASVALHKHSNALVDVLPPEADSSIMMLTSDQKPDVMYADIGGMDIQKQEVREAVELPLTHFELYKQIGIDPPRGVLMYGPPGCGKTMLAKAVAHHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEIDAIATKRFDAQTGADREVQRILLELLNQMDGFDQNVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLIFSTITSKMNLSEEVDLEDYVARPDKISGADINSICQESGMLAVRENRYIVLAKDFEKAYKTVIKKDEQEHEFYK psd10_human 26S proteasome non-ATPase regulatory subunit 10 26S proteasome regulatory subunit p28 Gankyrin PSMD10 p28(GANK) protein protein human Homo sapiens Human MEGCVSNLMVCNLAYSGKLEELKESILADKSLATRTDQDSRTALHWACSAGHTEIVEFLLQLGVPVNDKDDAGWSPLHIAASAGRDEIVKALLGKGAQVNAVNQNGCTPLHYAASKNRHEIAVMLLEGGANPDAKDHYEATAMHRAAAKGNLKMIHILLYYKASTNIQDTEGNTPLHLACDEERVEEAKLLVSQGASIYIENKEEKTPLQVAKGGLGLILKRMVEG prs8_human 26S proteasome regulatory subunit 8 PSMC5 SUG1 Proteasome 26S subunit ATPase 5 Proteasome subunit p45 p45/SUG Thyroid hormone receptor-interacting protein 1 26S proteasome AAA-ATPase subunit RPT6 protein protein human Homo sapiens Human MALDGPEQMELEEGKAGSGLRQYYLSKIEELQLIVNDKSQNLRRLQAQRNELNAKVRLLREELQLLQEQGSYVGEVVRAMDKKKVLVKVHPEGKFVVDVDKNIDINDVTPNCRVALRNDSYTLHKILPNKVDPLVSLMMVEKVPDSTYEMIGGLDKQIKEIKEVIELPVKHPELFEALGIAQPKGVLLYGPPGTGKTLLARAVAHHTDCTFIRVSGSELVQKFIGEGARMVRELFVMAREHAPSIIFMDEIDSIGSSRLEGGSGGDSEVQRTMLELLNQLDGFEATKNIKVIMATNRIDILDSALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMNLTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEKNMSIKKLWK 29C6410C4A85A7F7 paaf1_human Proteasomal ATPase-associated factor 1 PAAF1 WDR71 WD repeat-containing protein 71 Protein G-16 protein protein human Homo sapiens Human MAAPLRIQSDWAQALRKDEGEAWLSCHPPGKPSLYGSLTCQGIGLDGIPEVTASEGFTVNEINKKSIHISCPKENASSKFLAPYTTFSRIHTKSITCLDISSRGGLGVSSSTDGTMKIWQASNGELRRVLEGHVFDVNCCRFFPSGLVVLSGGMDAQLKIWSAEDASCVVTFKGHKGGILDTAIVDRGRNVVSASRDGTARLWDCGRSACLGVLADCGSSINGVAVGAADNSINLGSPEQMPSEREVGTEAKMLLLAREDKKLQCLGLQSRQLVFLFIGSDAFNCCTFLSGFLLLAGTQDGNIYQLDVRSPRAPVQVIHRSGAPVLSLLSVRDGFIASQGDGSCFIVQQDLDYVTELTGADCDPVYKVATWEKQIYTCCRDGLVRRYQLSDL prs7_human 26S proteasome regulatory subunit 7 PSMC2 MSS1 Proteasome 26S subunit ATPase 2 Protein MSS1 26S proteasome AAA-ATPase subunit RPT1 protein protein human Homo sapiens Human MPDYLGADQRKTKEDEKDDKPIRALDEGDIALLKTYGQSTYSRQIKQVEDDIQQLLKKINELTGIKESDTGLAPPALWDLAADKQTLQSEQPLQVARCTKIINADSEDPKYIINVKQFAKFVVDLSDQVAPTDIEEGMRVGVDRNKYQIHIPLPPKIDPTVTMMQVEEKPDVTYSDVGGCKEQIEKLREVVETPLLHPERFVNLGIEPPKGVLLFGPPGTGKTLCARAVANRTDACFIRVIGSELVQKYVGEGARMVRELFEMARTKKACLIFFDEIDAIGGARFDDGAGGDNEVQRTMLELINQLDGFDPRGNIKVLMATNRPDTLDPALMRPGRLDRKIEFSLPDLEGRTHIFKIHARSMSVERDIRFELLARLCPNSTGAEIRSVCTEAGMFAIRARRKIATEKDFLEAVNKVIKSYAKFSATPRYMTYN psmd5_human 26S proteasome non-ATPase regulatory subunit 5 26S proteasome subunit S5B 26S protease subunit S5 basic PSMD5 KIAA0072 protein protein human Homo sapiens Human MAAQALALLREVARLEAPLEELRALHSVLQAVPLNELRQQAAELRLGPLFSLLNENHREKTTLCVSILERLLQAMEPVHVARNLRVDLQRGLIHPDDSVKILTLSQIGRIVENSDAVTEILNNAELLKQIVYCIGGENLSVAKAAIKSLSRISLTQAGLEALFESNLLDDLKSVMKTNDIVRYRVYELIIEISSVSPESLNYCTTSGLVTQLLRELTGEDVLVRATCIEMVTSLAYTHHGRQYLAQEGVIDQISNIIVGADSDPFSSFYLPGFVKFFGNLAVMDSPQQICERYPIFVEKVFEMIESQDPTMIGVAVDTVGILGSNVEGKQVLQKTGTRFERLLMRIGHQSKNAPVELKIRCLDAISSLLYLPPEQQTDDLLRMTESWFSSLSRDPLELFRGISSQPFPELHCAALKVFTAIANQPWAQKLMFNSPGFVEYVVDRSVEHDKASKDAKYELVKALANSKTIAEIFGNPNYLRLRTYLSEGPYYVKPVSTTAVEGAE prs4_human 26S proteasome regulatory subunit 4 PSMC1 26S proteasome AAA-ATPase subunit RPT2 Proteasome 26S subunit ATPase 1 protein protein human Homo sapiens Human MGQSQSGGHGPGGGKKDDKDKKKKYEPPVPTRVGKKKKKTKGPDAASKLPLVTPHTQCRLKLLKLERIKDYLLMEEEFIRNQEQMKPLEEKQEEERSKVDDLRGTPMSVGTLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDLLEPGCSVLLNHKVHAVIGVLMDDTDPLVTVMKVEKAPQETYADIGGLDNQIQEIKESVELPLTHPEYYEEMGIKPPKGVILYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPSIVFIDEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDGFDSRGDVKVIMATNRIETLDPALIRPGRIDRKIEFPLPDEKTKKRIFQIHTSRMTLADDVTLDDLIMAKDDLSGADIKAICTEAGLMALRERRMKVTNEDFKKSKENVLYKKQEGTPEGLYL psmd2_human 26S proteasome non-ATPase regulatory subunit 2 PSMD2 TRAP2 26S proteasome regulatory subunit RPN1 26S proteasome regulatory subunit S2 26S proteasome subunit p97 Tumor necrosis factor type 1 receptor-associated protein 2 Protein 55.11 protein protein human Homo sapiens Human MEEGGRDKAPVQPQQSPAAAPGGTDEKPSGKERRDAGDKDKEQELSEEDKQLQDELEMLVERLGEKDTSLYRPALEELRRQIRSSTTSMTSVPKPLKFLRPHYGKLKEIYENMAPGENKRFAADIISVLAMTMSGERECLKYRLVGSQEELASWGHEYVRHLAGEVAKEWQELDDAEKVQREPLLTLVKEIVPYNMAHNAEHEACDLLMEIEQVDMLEKDIDENAYAKVCLYLTSCVNYVPEPENSALLRCALGVFRKFSRFPEALRLALMLNDMELVEDIFTSCKDVVVQKQMAFMLGRHGVFLELSEDVEEYEDLTEIMSNVQLNSNFLALARELDIMEPKVPDDIYKTHLENNRFGGSGSQVDSARMNLASSFVNGFVNAAFGQDKLLTDDGNKWLYKNKDHGMLSAAASLGMILLWDVDGGLTQIDKYLYSSEDYIKSGALLACGIVNSGVRNECDPALALLSDYVLHNSNTMRLGSIFGLGLAYAGSNREDVLTLLLPVMGDSKSSMEVAGVTALACGMIAVGSCNGDVTSTILQTIMEKSETELKDTYARWLPLGLGLNHLGKGEAIEAILAALEVVSEPFRSFANTLVDVCAYAGSGNVLKVQQLLHICSEHFDSKEKEEDKDKKEKKDKDKKEAPADMGAHQGVAVLGIALIAMGEEIGAEMALRTFGHLLRYGEPTLRRAVPLALALISVSNPRLNILDTLSKFSHDADPEVSYNSIFAMGMVGSGTNNARLAAMLRQLAQYHAKDPNNLFMVRLAQGLTHLGKGTLTLCPYHSDRQLMSQVAVAGLLTVLVSFLDVRNIILGKSHYVLYGLVAAMQPRMLVTFDEELRPLPVSVRVGQAVDVVGQAGKPKTITGFQTHTTPVLLAHGERAELATEEFLPVTPILEGFVILRKNPNYDL psmd9_human 26S proteasome non-ATPase regulatory subunit 9 26S proteasome regulatory subunit p27 PSMD9 protein protein human Homo sapiens Human MSDEEARQSGGSSQAGVVTVSDVQELMRRKEEIEAQIKANYDVLESQKGIGMNEPLVDCEGYPRSDVDLYQVRTARHNIICLQNDHKAVMKQVEEALHQLHARDKEKQARDMAEAHKEAMSRKLGQSESQGPPRAFAKVNSISPGSPASIAGLQVDDEIVEFGSVNTQNFQSLHNIGSVVQHSEGKPLNVTVIRRGEKHQLRLVPTRWAGKGLLGCNIIPLQR prs6a_human 26S proteasome regulatory subunit 6A PSMC3 TBP1 Proteasome 26S subunit ATPase 3 Tat-binding protein 1 Proteasome subunit P50 26S proteasome AAA-ATPase subunit RPT5 protein protein human Homo sapiens Human MNLLPNIESPVTRQEKMATVWDEAEQDGIGEEVLKMSTEEIIQRTRLLDSEIKIMKSEVLRVTHELQAMKDKIKENSEKIKVNKTLPYLVSNVIELLDVDPNDQEEDGANIDLDSQRKGKCAVIKTSTRQTYFLPVIGLVDAEKLKPGDLVGVNKDSYLILETLPTEYDSRVKAMEVDERPTEQYSDIGGLDKQIQELVEAIVLPMNHKEKFENLGIQPPKGVLMYGPPGTGKTLLARACAAQTKATFLKLAGPQLVQMFIGDGAKLVRDAFALAKEKAPSIIFIDELDAIGTKRFDSEKAGDREVQRTMLELLNQLDGFQPNTQVKVIAATNRVDILDPALLRSGRLDRKIEFPMPNEEARARIMQIHSRKMNVSPDVNYEELARCTDDFNGAQCKAVCVEAGMIALRRGATELTHEDYMEGILEVQAKKKANLQYYA prs10_human 26S proteasome regulatory subunit 10B PSMC6 SUG2 Proteasome 26S subunit ATPase 6 Proteasome subunit p42 26S proteasome AAA-ATPase subunit RPT4 protein protein human Homo sapiens Human MADPRDKALQDYRKKLLEHKEIDGRLKELREQLKELTKQYEKSENDLKALQSVGQIVGEVLKQLTEEKFIVKATNGPRYVVGCRRQLDKSKLKPGTRVALDMTTLTIMRYLPREVDPLVYNMSHEDPGNVSYSEIGGLSEQIRELREVIELPLTNPELFQRVGIIPPKGCLLYGPPGTGKTLLARAVASQLDCNFLKVVSSSIVDKYIGESARLIREMFNYARDHQPCIIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQMDGFDTLHRVKMIMATNRPDTLDPALLRPGRLDRKIHIDLPNEQARLDILKIHAGPITKHGEIDYEAIVKLSDGFNGADLRNVCTEAGMFAIRADHDFVVQEDFMKAVRKVADSKKLESKLDYKPV psmd1_human 26S proteasome non-ATPase regulatory subunit 1 PSMD1 26S proteasome regulatory subunit RPN2 26S proteasome regulatory subunit S1 26S proteasome subunit p112 protein protein human Homo sapiens Human MITSAAGIISLLDEDEPQLKEFALHKLNAVVNDFWAEISESVDKIEVLYEDEGFRSRQFAALVASKVFYHLGAFEESLNYALGAGDLFNVNDNSEYVETIIAKCIDHYTKQCVENADLPEGEKKPIDQRLEGIVNKMFQRCLDDHKYKQAIGIALETRRLDVFEKTILESNDVPGMLAYSLKLCMSLMQNKQFRNKVLRVLVKIYMNLEKPDFINVCQCLIFLDDPQAVSDILEKLVKEDNLLMAYQICFDLYESASQQFLSSVIQNLRTVGTPIASVPGSTNTGTVPGSEKDSDSMETEEKTSSAFVGKTPEASPEPKDQTLKMIKILSGEMAIELHLQFLIRNNNTDLMILKNTKDAVRNSVCHTATVIANSFMHCGTTSDQFLRDNLEWLARATNWAKFTATASLGVIHKGHEKEALQLMATYLPKDTSPGSAYQEGGGLYALGLIHANHGGDIIDYLLNQLKNASNDIVRHGGSLGLGLAAMGTARQDVYDLLKTNLYQDDAVTGEAAGLALGLVMLGSKNAQAIEDMVGYAQETQHEKILRGLAVGIALVMYGRMEEADALIESLCRDKDPILRRSGMYTVAMAYCGSGNNKAIRRLLHVAVSDVNDDVRRAAVESLGFILFRTPEQCPSVVSLLSESYNPHVRYGAAMALGICCAGTGNKEAINLLEPMTNDPVNYVRQGALIASALIMIQQTEITCPKVNQFRQLYSKVINDKHDDVMAKFGAILAQGILDAGGHNVTISLQSRTGHTHMPSVVGVLVFTQFWFWFPLSHFLSLAYTPTCVIGLNKDLKMPKVQYKSNCKPSTFAYPAPLEVPKEKEKEKVSTAVLSITAKAKKKEKEKEKKEEEKMEVDEAEKKEEKEKKKEPEPNFQLLDNPARVMPAQLKVLTMPETCRYQPFKPLSIGGIIILKDTSEDIEELVEPVAAHGPKIEEEEQEPEPPEPFEYIDD psmd3_human 26S proteasome non-ATPase regulatory subunit 3 PSMD3 Proteasome subunit p58 26S proteasome regulatory subunit S3 26S proteasome regulatory subunit RPN3 protein protein human Homo sapiens Human MKQEGSARRRGADKAKPPPGGGEQEPPPPPAPQDVEMKEEAATGGGSTGEADGKTAAAAAEHSQRELDTVTLEDIKEHVKQLEKAVSGKEPRFVLRALRMLPSTSRRLNHYVLYKAVQGFFTSNNATRDFLLPFLEEPMDTEADLQFRPRTGKAASTPLLPEVEAYLQLLVVIFMMNSKRYKEAQKISDDLMQKISTQNRRALDLVAAKCYYYHARVYEFLDKLDVVRSFLHARLRTATLRHDADGQATLLNLLLRNYLHYSLYDQAEKLVSKSVFPEQANNNEWARYLYYTGRIKAIQLEYSEARRTMTNALRKAPQHTAVGFKQTVHKLLIVVELLLGEIPDRLQFRQPSLKRSLMPYFLLTQAVRTGNLAKFNQVLDQFGEKFQADGTYTLIIRLRHNVIKTGVRMISLSYSRISLADIAQKLQLDSPEDAEFIVAKAIRDGVIEASINHEKGYVQSKEMIDIYSTREPQLAFHQRISFCLDIHNMSVKAMRFPPKSYNKDLESAEERREREQQDLEFAKEMAEDDDDSFP psd12_human 26S proteasome non-ATPase regulatory subunit 12 PSMD12 26S proteasome regulatory subunit p55 26S proteasome regulatory subunit RPN5 protein protein human Homo sapiens Human MADGGSERADGRIVKMEVDYSATVDQRLPECAKLAKEGRLQEVIETLLSLEKQTRTASDMVSTSRILVAVVKMCYEAKEWDLLNENIMLLSKRRSQLKQAVAKMVQQCCTYVEEITDLPIKLRLIDTLRMVTEGKIYVEIERARLTKTLATIKEQNGDVKEAASILQELQVETYGSMEKKERVEFILEQMRLCLAVKDYIRTQIISKKINTKFFQEENTEKLKLKYYNLMIQLDQHEGSYLSICKHYRAIYDTPCIQAESEKWQQALKSVVLYVILAPFDNEQSDLVHRISGDKKLEEIPKYKDLLKLFTTMELMRWSTLVEDYGMELRKGSLESPATDVFGSTEEGEKRWKDLKNRVVEHNIRIMAKYYTRITMKRMAQLLDLSVDESEAFLSNLVVNKTIFAKVDRLAGIINFQRPKDPNNLLNDWSQKLNSLMSLVNKTTHLIAKEEMIHNLQ psmd6_human 26S proteasome non-ATPase regulatory subunit 6 PSMD6 KIAA0107 PFAAP4 26S proteasome regulatory subunit S10 p42A Proteasome regulatory particle subunit p44S10 Phosphonoformate immuno-associated protein 4 Breast cancer-associated protein SGA-113M 26S proteasome regulatory subunit RPN7 protein protein human Homo sapiens Human MPLENLEEEGLPKNPDLRIAQLRFLLSLPEHRGDAAVRDELMAAVRDNNMAPYYEALCKSLDWQIDVDLLNKMKKANEDELKRLDEELEDAEKNLGESEIRDAMMAKAEYLCRIGDKEGALTAFRKTYDKTVALGHRLDIVFYLLRIGLFYMDNDLITRNTEKAKSLIEEGGDWDRRNRLKVYQGLYCVAIRDFKQAAELFLDTVSTFTSYELMDYKTFVTYTVYVSMIALERPDLREKVIKGAEILEVLHSLPAVRQYLFSLYECRYSVFFQSLAVVEQEMKKDWLFAPHYRYYVREMRIHAYSQLLESYRSLTLGYMAEAFGVGVEFIDQELSRFIAAGRLHCKIDKVNEIVETNRPDSKNWQYQETIKKGDLLLNRVQKLSRVINM psa5_human Proteasome subunit alpha type-5 PSMA5 Proteasome zeta chain Macropain zeta chain Multicatalytic endopeptidase complex zeta chain protein protein human Homo sapiens Human MFLTRSEYDRGVNTFSPEGRLFQVEYAIEAIKLGSTAIGIQTSEGVCLAVEKRITSPLMEPSSIEKIVEIDAHIGCAMSGLIADAKTLIDKARVETQNHWFTYNETMTVESVTQAVSNLALQFGEEDADPGAMSRPFGVALLFGGVDEKGPQLFHMDPSGTFVQCDARAIGSASEGAQSSLQEVYHKSMTLKEAIKSSLIILKQVMEEKLNATNIELATVQPGQNFHMFTKEELEEVIKDI psmd8_human 26S proteasome non-ATPase regulatory subunit 8 PSMD8 26S proteasome regulatory subunit S14 p31 26S proteasome regulatory subunit RPN12 protein protein human Homo sapiens Human MFIKGRAPRAPPRERRRATRGGLRQVVAPPRALGSTSRPHFRRASVCRRRCRKSGGLLAASRKMAAAAVNGAAGFSSSGPAATSGAVLQAATGMYEQLKGEWNRKSPNLSKCGEELGRLKLVLLELNFLPTTGTKLTKQQLILARDILEIGAQWSILRKDIPSFERYMAQLKCYYFDYKEQLPESAYMHQLLGLNLLFLLSQNRVAEFHTELERLPAKDIQTNVYIKHPVSLEQYLMEGSYNKVFLAKGNIPAESYTFFIDILLDTIRDEIAGCIEKAYEKILFTEATRILFFNTPKKMTDYAKKRGWVLGPNNYYSFASQQQKPEDTTIPSTELAKQVIEYARQLEMIV psa6_human Proteasome subunit alpha type-6 PSMA6 PROS27 Proteasome iota chain Macropain iota chain Multicatalytic endopeptidase complex iota chain 27 kDa prosomal protein protein protein human Homo sapiens Human MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKLLDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIADISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLEKKVKKKFDWTFEQTVETAITCLSTVLSIDFKPSEIEVGVVTVENPKFRILTEAEIDAHLVALAERD psde_human 26S proteasome non-ATPase regulatory subunit 14 26S proteasome regulatory subunit RPN11 26S proteasome-associated PAD1 homolog 1 PSMD14 POH1 protein protein human Homo sapiens Human MDRLLRLGGGMPGLGQGPPTDAPAVDTAEQVYISSLALLKMLKHGRAGVPMEVMGLMLGEFVDDYTVRVIDVFAMPQSGTGVSVEAVDPVFQAKMLDMLKQTGRPEMVVGWYHSHPGFGCWLSGVDINTQQSFEALSERAVAVVVDPIQSVKGKVVIDAFRLINANMMVLGHEPRQTTSNLGHLNKPSIQALIHGLNRHYYSITINYRKNELEQKMLLNLHKKSWMEGLTLQDYSEHCKHNESVVKEMLELAKNYNKAVEEEDKMTPEQLAIKNVGKQDPKRHLEEHVDVLMTSNIVQCLAAMLDTVVFK psd13_human 26S proteasome non-ATPase regulatory subunit 13 PSMD13 26S proteasome regulatory subunit S11 26S proteasome regulatory subunit p40.5 26S proteasome regulatory subunit RPN9 protein protein human Homo sapiens Human MKDVPGFLQQSQNSGPGQPAVWHRLEELYTKKLWHQLTLQVLDFVQDPCFAQGDGLIKLYENFISEFEHRVNPLSLVEIILHVVRQMTDPNVALTFLEKTREKVKSSDEAVILCKTAIGALKLNIGDLQVTKETIEDVEEMLNNLPGVTSVHSRFYDLSSKYYQTIGNHASYYKDALRFLGCVDIKDLPVSEQQERAFTLGLAGLLGEGVFNFGELLMHPVLESLRNTDRQWLIDTLYAFNSGNVERFQTLKTAWGQQPDLAANEAQLLRKIQLLCLMEMTFTRPANHRQLTFEEIAKSAKITVNEVELLVMKALSVGLVKGSIDEVDKRVHMTWVQPRVLDLQQIKGMKDRLEFWCTDVKSMEMLVEHQAHDILT psd11_human 26S proteasome non-ATPase regulatory subunit 11 PSMD11 26S proteasome regulatory subunit S9 26S proteasome regulatory subunit p44.5 26S proteasome regulatory subunit RPN6 protein protein human Homo sapiens Human MAAAAVVEFQRAQSLLSTDREASIDILHSIVKRDIQENDEEAVQVKEQSILELGSLLAKTGQAAELGGLLKYVRPFLNSISKAKAARLVRSLLDLFLDMEAATGQEVELCLECIEWAKSEKRTFLRQALEARLVSLYFDTKRYQEALHLGSQLLRELKKMDDKALLVEVQLLESKTYHALSNLPKARAALTSARTTANAIYCPPKLQATLDMQSGIIHAAEEKDWKTAYSYFYEAFEGYDSIDSPKAITSLKYMLLCKIMLNTPEDVQALVSGKLALRYAGRQTEALKCVAQASKNRSLADFEKALTDYRAELRDDPIISTHLAKLYDNLLEQNLIRVIEPFSRVQIEHISSLIKLSKADVERKLSQMILDKKFHGILDQGEGVLIIFDEPPVDKTYEAALETIQNMSKVVDSLYNKAKKLT adrm1_human Proteasomal ubiquitin receptor ADRM1 Adhesion-regulating molecule 1 110 kDa cell membrane glycoprotein Rpn13 homolog Proteasome regulatory particle non-ATPase 13 ADRM1 GP110 protein protein human Homo sapiens Human MTTSGALFPSLVPGSRGASNKYLVEFRAGKMSLKGTTVTPDKRKGLVYIQQTDDSLIHFCWKDRTSGNVEDDLIIFPDDCEFKRVPQCPSGRVYVLKFKAGSKRLFFWMQEPKTDQDEEHCRKVNEYLNNPPMPGALGASGSSGHELSALGGEGGLQSLLGNMSHSQLMQLIGPAGLGGLGGLGALTGPGLASLLGSSGPPGSSSSSSSRSQSAAVTPSSTTSSTRATPAPSAPAAASATSPSPAPSSGNGASTAASPTQPIQLSDLQSILATMNVPAGPAGGQQVDLASVLTPEIMAPILANADVQERLLPYLPSGESLPQTADEIQNTLTSPQFQQALGMFSAALASGQLGPLMCQFGLPAEAVEAANKGDVEAFAKAMQNNAKPEQKEGDTKDKKDEEEDMSLD psmd7_human 26S proteasome non-ATPase regulatory subunit 7 PSMD7 MOV34L 26S proteasome regulatory subunit RPN8 26S proteasome regulatory subunit S12 Proteasome subunit p40 Mov34 protein homolog protein protein human Homo sapiens Human MPELAVQKVVVHPLVLLSVVDHFNRIGKVGNQKRVVGVLLGSWQKKVLDVSNSFAVPFDEDDKDDSVWFLDHDYLENMYGMFKKVNARERIVGWYHTGPKLHKNDIAINELMKRYCPNSVLVIIDVKPKDLGLPTEAYISVEEVHDDGTPTSKTFEHVTSEIGAEEAEEVGVEHLLRDIKDTTVGTLSQRITNQVHGLKGLNSKLLDIRSYLEKVATGKLPINHQIIYQLQDVFNLLPDVSLQEFVKAFYLKTNDQMVVVYLASLIRSVVALHNLINNKIANRDAEKKEGQEKEESKKDRKEDKEKDKDKEKSDVKKEEKKEKK psmd4_human 26S proteasome non-ATPase regulatory subunit 4 PSMD4 MCB1 26S proteasome regulatory subunit S5A 26S proteasome regulatory subunit RPN10 Multiubiquitin chain-binding protein Antisecretory factor 1 protein protein human Homo sapiens Human MVLESTMVCVDNSEYMRNGDFLPTRLQAQQDAVNIVCHSKTRSNPENNVGLITLANDCEVLTTLTPDTGRILSKLHTVQPKGKITFCTGIRVAHLALKHRQGKNHKMRIIAFVGSPVEDNEKDLVKLAKRLKKEKVNVDIINFGEEEVNTEKLTAFVNTLNGKDGTGSHLVTVPPGPSLADALISSPILAGEGGAMLGLGASDFEFGVDPSADPELALALRVSMEEQRQRQEEEARRAAAASAAEAGIATTGTEDSDDALLKMTISQQEFGRTGLPDLSSMTEEEQIAYAMQMSLQGAEFGQAESADIDASSAMDTSEPAKEEDDYDVMQDPEFLQSVLENLPGVDPNNEAIRNAMGSLASQATKDGKKDKKEEDKK uchl5_human Ubiquitin carboxyl-terminal hydrolase isozyme L5 Ubiquitin thioesterase L5 Ubiquitin C-terminal hydrolase UCH37 UCHL5 UCH37 AD-019 CGI-70 protein protein human Homo sapiens Human MTGNAGEWCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPENFEKLKPVHGLIFLFKWQPGEEPAGSVVQDSRLDTIFFAKQVINNACATQAIVSVLLNCTHQDVHLGETLSEFKEFSQSFDAAMKGLALSNSDVIRQVHNSFARQQMFEFDTKTSAKEEDAFHFVSYVPVNGRLYELDGLREGPIDLGACNQDDWISAVRPVIEKRIQKYSEGEIRFNLMAIVSDRKMIYEQKIAELQRQLAEEEPMDTDQGNSMLSAIQSEVAKNQMLIEEEVQKLKRYKIENIRRKHNYLPFIMELLKTLAEHQQLIPLVEKAKEKQNAKKAQETK ubp14_human Ubiquitin carboxyl-terminal hydrolase 14 USP14 TGT Ubiquitin-specific-processing protease 14 Deubiquitinating enzyme 14 Ubiquitin thioesterase 14 protein protein human Homo sapiens Human MPLYSVTVKWGKEKFEGVELNTDEPPMVFKAQLFALTGVQPARQKVMVKGGTLKDDDWGNIKIKNGMTLLMMGSADALPEEPSAKTVFVEDMTEEQLASAMELPCGLTNLGNTCYMNATVQCIRSVPELKDALKRYAGALRASGEMASAQYITAALRDLFDSMDKTSSSIPPIILLQFLHMAFPQFAEKGEQGQYLQQDANECWIQMMRVLQQKLEAIEDDSVKETDSSSASAATPSKKKSLIDQFFGVEFETTMKCTESEEEEVTKGKENQLQLSCFINQEVKYLFTGLKLRLQEEITKQSPTLQRNALYIKSSKISRLPAYLTIQMVRFFYKEKESVNAKVLKDVKFPLMLDMYELCTPELQEKMVSFRSKFKDLEDKKVNQQPNTSDKKSSPQKEVKYEPFSFADDIGSNNCGYYDLQAVLTHQGRSSSSGHYVSWVKRKQDEWIKFDDDKVSIVTPEDILRLSGGGDWHIAYVLLYGPRRVEIMEEESEQ psb3_human Proteasome subunit beta type-3 PSMB3 Proteasome theta chain Proteasome chain 13 Proteasome component C10-II protein protein human Homo sapiens Human MSIMSYNGGAVMAMKGKNCVAIAADRRFGIQAQMVTTDFQKIFPMGDRLYIGLAGLATDVQTVAQRLKFRLNLYELKEGRQIKPYTLMSMVANLLYEKRFGPYYTEPVIAGLDPKTFKPFICSLDLIGCPMVTDDFVVSGTCAEQMYGMCESLWEPNMDPDHLFETISQAMLNAVDRDAVSGMGVIVHIIEKDKITTRTLKARMD psb4_human Proteasome subunit beta type-4 PSMB4 Macropain beta chain Multicatalytic endopeptidase complex beta chain Proteasome chain 3 26 kDa prosomal protein PROS26 Proteasome beta chain protein protein human Homo sapiens Human MEAFLGSRSGLWAGGPAPGQFYRIPSTPDSFMDPASALYRGPITRTQNPMVTGTSVLGVKFEGGVVIAADMLGSYGSLARFRNISRIMRVNNSTMLGASGDYADFQYLKQVLGQMVIDEELLGDGHSYSPRAIHSWLTRAMYSRRSKMNPLWNTMVIGGYADGESFLGYVDMLGVAYEAPSLATGYGAYLAQPLLREVLEKQPVLSQTEARDLVERCMRVLYYRDARSYNRFQIATVTEKGVEIEGPLSTETNWDIAHMISGFE psb2_human Proteasome subunit beta type-2 PSMB2 Multicatalytic endopeptidase complex subunit C7-I Proteasome component C7-I Macropain subunit C7-I protein protein human Homo sapiens Human MEYLIGIQGPDYVLVASDRVAASNIVQMKDDHDKMFKMSEKILLLCVGEAGDTVQFAEYIQKNVQLYKMRNGYELSPTAAANFTRRNLADCLRSRTPYHVNLLLAGYDEHEGPALYYMDYLAALAKAPFAAHGYGAFLTLSILDRYYTPTISRERAVELLRKCLEELQKRFILNLPTFSVRIIDKNGIHDLDNISFPKQGS psb1_human Proteasome subunit beta type-1 PSMB1 PSC5 Proteasome component C5 Macropain subunit C5 Multicatalytic endopeptidase complex subunit C5 Proteasome gamma chain protein protein human Homo sapiens Human MLSSTAMYSAPGRDLGMEPHRAAGPLQLRFSPYVFNGGTILAIAGEDFAIVASDTRLSEGFSIHTRDSPKCYKLTDKTVIGCSGFHGDCLTLTKIIEARLKMYKHSNNKAMTTGAIAAMLSTILYSRRFFPYYVYNIIGGLDEEGKGAVYSFDPVGSYQRDSFKAGGSASAMLQPLLDNQVGFKNMQNVEHVPLSLDRAMRLVKDVFISAAERDVYTGDALRICIVTKEGIREETVSLRKD psb7_human Proteasome subunit beta type-7 PSMB7 Proteasome subunit Z Macropain chain Z Multicatalytic endopeptidase complex chain Z Z protein protein human Homo sapiens Human MAAVSVYAPPVGGFSFDNCRRNAVLEADFAKRGYKLPKVRKTGTTIAGVVYKDGIVLGADTRATEGMVVADKNCSKIHFISPNIYCCGAGTAADTDMTTQLISSNLELHSLSTGRLPRVVTANRMLKQMLFRYQGYIGAALVLGGVDVTGPHLYSIYPHGSTDKLPYVTMGSGSLAAMAVFEDKFRPDMEEEEAKNLVSEAIAAGIFNDLGSGSNIDLCVISKNKLDFLRPYTVPNKKGTRLGRYRCEKGTTAVLTEKITPLEIEVLEETVQTMDTS psa3_human Proteasome subunit alpha type-3 PSMA3 PSC8 Proteasome component C8 Macropain subunit C8 Multicatalytic endopeptidase complex subunit C8 HC8 protein protein human Homo sapiens Human MSSIGTGYDLSASTFSPDGRVFQVEYAMKAVENSSTAIGIRCKDGVVFGVEKLVLSKLYEEGSNKRLFNVDRHVGMAVAGLLADARSLADIAREEASNFRSNFGYNIPLKHLADRVAMYVHAYTLYSAVRPFGCSFMLGSYSVNDGAQLYMIDPSGVSYGYWGCAIGKARQAAKTEIEKLQMKEMTCRDIVKEVAKIIYIVHDEVKDKAFELELSWVGELTNGRHEIVPKDIREEAEKYAKESLKEEDESDDDNM psa1_human Proteasome subunit alpha type-1 PSMA1 PROS30 PSC2 Proteasome component C2 Macropain subunit C2 Multicatalytic endopeptidase complex subunit C2 Proteasome nu chain 30 kDa prosomal protein HC2 NU protein protein human Homo sapiens Human MFRNQYDNDVTVWSPQGRIHQIEYAMEAVKQGSATVGLKSKTHAVLVALKRAQSELAAHQKKILHVDNHIGISIAGLTADARLLCNFMRQECLDSRFVFDRPLPVSRLVSLIGSKTQIPTQRYGRRPYGVGLLIAGYDDMGPHIFQTCPSANYFDCRAMSIGARSQSARTYLERHMSEFMECNLNELVKHGLRALRETLPAEQDLTTKNVSIGIVGKDLEFTIYDDDDVSPFLEGLEERPQRKAQPAQPADEPAEKADEPMEH psa4_human Proteasome subunit alpha type-4 PSMA4 PSC9 Proteasome component C9 Macropain subunit C9 Multicatalytic endopeptidase complex subunit C9 Proteasome subunit L HC9 protein protein human Homo sapiens Human MSRRYDSRTTIFSPEGRLYQVEYAMEAIGHAGTCLGILANDGVLLAAERRNIHKLLDEVFFSEKIYKLNEDMACSVAGITSDANVLTNELRLIAQRYLLQYQEPIPCEQLVTALCDIKQAYTQFGGKRPFGVSLLYIGWDKHYGFQLYQSDPSGNYGGWKATCIGNNSAAAVSMLKQDYKEGEMTLKSALALAIKVLNKTMDVSKLSAEKVEIATLTRENGKTVIRVLKQKEVEQLIKKHEEEEAKAEREKKEKEQKEKDK psa2_human Proteasome subunit alpha type-2 PSMA2 PSC3 Proteasome component C3 Macropain subunit C3 Multicatalytic endopeptidase complex subunit C3 HC3 protein protein human Homo sapiens Human MAERGYSFSLTTFSPSGKLVQIEYALAAVAGGAPSVGIKAANGVVLATEKKQKSILYDERSVHKVEPITKHIGLVYSGMGPDYRVLVHRARKLAQQYYLVYQEPIPTAQLVQRVASVMQEYTQSGGVRPFGVSLLICGWNEGRPYLFQSDPSGAYFAWKATAMGKNYVNGKTFLEKRYNEDLELEDAIHTAILTLKESFEGQMTEDNIEVGICNEAGFRRLTPTEVKDYLAAIA psa7_human Proteasome subunit alpha type-7 PSMA7 Proteasome subunit RC6-1 Proteasome subunit XAPC7 HSPC protein protein human Homo sapiens Human MSYDRAITVFSPDGHLFQVEYAQEAVKKGSTAVGVRGRDIVVLGVEKKSVAKLQDERTVRKICALDDNVCMAFAGLTADARIVINRARVECQSHRLTVEDPVTVEYITRYIASLKQRYTQSNGRRPFGISALIVGFDFDGTPRLYQTDPSGTYHAWKANAIGRGAKSVREFLEKNYTDEAIETDDLTIKLVIKALLEVVQSGGKNIELAVMRRDQSLKILNPEEIEKYVAEIEKEKEENEKKKQKKAS ubb_human Polyubiquitin-B UBB protein protein human Homo sapiens Human MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGC psmd10-psmc4-1 Interaction between PSMD10 and PSMC4 832889 n/a 832895 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro n/a 832896 unspecified role unspecified role bait bait region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro direct interaction direct interaction false false false Fig. 2A psmc5-psmc4-2 Interaction between PSMC5 and PSMC4 832889 n/a 832897 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro n/a 832895 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro direct interaction direct interaction false false false Fig. 2A psmc5-psmc4-1 Interaction between PSMC5 and PSMC4 832889 n/a 832897 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro n/a 832895 unspecified role unspecified role bait bait region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro direct interaction direct interaction false false false Fig. 2A paaf1-psmc5-1 Interaction between PAAF1 and PSMC5 832889 n/a 832897 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro n/a 832898 unspecified role unspecified role bait bait region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro direct interaction direct interaction false false false Fig. 2A psmd5-psmc2-1 Interaction between PSMD5 and PSMC2 832889 n/a 832899 unspecified role unspecified role prey prey region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro n/a 832900 unspecified role unspecified role bait bait n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro direct interaction direct interaction false false false Fig. 2B psmc2-psmc1-1 Interaction between PSMC2 and PSMC1 832889 n/a 832899 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro n/a 832901 unspecified role unspecified role prey prey region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro direct interaction direct interaction false false false Fig. 2B psmc2-psmc1-2 Interaction between PSMC2 and PSMC1 832889 n/a 832899 unspecified role unspecified role prey prey region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro n/a 832901 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro direct interaction direct interaction false false false Fig. 2B psmc2-psmc1-3 Interaction between PSMC2 and PSMC1 832889 n/a 832901 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro n/a 832902 unspecified role unspecified role prey prey region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro direct interaction direct interaction false false false Fig. 2B psmd9-psmc3-1 Interaction between PSMD9 and PSMC3 832889 n/a 832903 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro n/a 832904 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro direct interaction direct interaction false false false Fig. 2C psmc6-psmc3-1 Interaction between PSMC6 and PSMC3 832889 n/a 832904 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro n/a 832905 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro direct interaction direct interaction false false false Fig. 2C psmc6-psmc3-2 Interaction between PSMC6 and PSMC3 832889 n/a 832905 unspecified role unspecified role prey prey region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro n/a 832904 unspecified role unspecified role bait bait region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro direct interaction direct interaction false false false Fig. 2C psmd10-psmc5-3 Interactors of PSMD10 (p28) 832890 n/a 832896 unspecified role unspecified role bait bait n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n/a 832895 unspecified role unspecified role prey prey n/a 832897 unspecified role unspecified role prey prey n/a 832898 unspecified role unspecified role prey prey association association false false false Fig. 1B Size of complex = 160kDa psmd5-psmd2-1 Interactors of PSMD5 (S5b) 832890 n/a 832901 unspecified role unspecified role prey prey n/a 832902 unspecified role unspecified role prey prey n/a 832899 unspecified role unspecified role prey prey n/a 832900 unspecified role unspecified role bait bait n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false association association false false false Fig. 1C Size of complex = 350kDa psmd9-psmc6-3 Interactors of PSMD9 (p27) 832890 n/a 832904 unspecified role unspecified role prey prey n/a 832903 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 832905 unspecified role unspecified role prey prey association association false false false Fig. 1D Size of complex = 120kDa psmc6-psmc4-1 Interactors of PSMC6 (Rpt4) in presence of Rpt1/2 siRNA 832890 n/a 832897 unspecified role unspecified role prey prey n/a 832895 unspecified role unspecified role prey prey n/a 832904 unspecified role unspecified role prey prey n/a 832905 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 832896 unspecified role unspecified role prey prey association association false false false Figs. 4B and 4E Cells treated with siRNA targeting Rpt1/Rpt2 before glycerol gradient separation. psmc6-psmc3-3 Interactors of PSMC6 (Rpt4) in presence of Rpt3/6 siRNA 832890 n/a 832899 unspecified role unspecified role prey prey n/a 832902 unspecified role unspecified role prey prey n/a 832901 unspecified role unspecified role prey prey n/a 832905 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 832904 unspecified role unspecified role prey prey association association false false false Figs. 4C and 4E Cells treated with siRNA targeting Rpt3/Rpt6 before glycerol gradient separation. psmc5-psmd2-1 Interactors of PSMC5 (Rpt6) in presence of Rpt4/5 siRNA 832890 n/a 832902 unspecified role unspecified role prey prey n/a 832899 unspecified role unspecified role prey prey n/a 832906 unspecified role unspecified role prey prey n/a 832895 unspecified role unspecified role prey prey n/a 832898 unspecified role unspecified role prey prey n/a 832896 unspecified role unspecified role prey prey n/a 832897 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 832901 unspecified role unspecified role prey prey association association false false false Figs. 4D and 4E Cells treated with siRNA targeting Rpt4/Rpt5 before glycerol gradient separation. Heat shock proteins 90 and 70 were also observed but could not be ascribed to a single gene product. psmc5-psmd2-2 Interactors of PSMC5 (Rpt6) 832890 n/a 832904 unspecified role unspecified role prey prey n/a 832905 unspecified role unspecified role prey prey n/a 832897 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 832901 unspecified role unspecified role prey prey n/a 832895 unspecified role unspecified role prey prey n/a 832899 unspecified role unspecified role prey prey n/a 832906 unspecified role unspecified role prey prey n/a 832902 unspecified role unspecified role prey prey association association false false false Figs. 4A and 4E Heat shock proteins 90 and 70 were also observed but could not be ascribed to a single gene product. psmc5-psmd2-3 Interactors of PSMC5 (Rpt6) - fraction 18 832890 n/a 832896 unspecified role unspecified role prey prey n/a 832907 unspecified role unspecified role prey prey n/a 832902 unspecified role unspecified role prey prey n/a 832899 unspecified role unspecified role prey prey n/a 832906 unspecified role unspecified role prey prey n/a 832897 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 832895 unspecified role unspecified role prey prey n/a 832901 unspecified role unspecified role prey prey association association false false false Figs. 4F psmc5-psmd2-4 Interactors of PSMC5 (Rpt6) 832890 n/a 832895 unspecified role unspecified role prey prey n/a 832896 unspecified role unspecified role prey prey n/a 832897 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 832902 unspecified role unspecified role prey prey n/a 832904 unspecified role unspecified role prey prey n/a 832906 unspecified role unspecified role prey prey n/a 832899 unspecified role unspecified role prey prey n/a 832907 unspecified role unspecified role prey prey n/a 832905 unspecified role unspecified role prey prey n/a 832901 unspecified role unspecified role prey prey association association false false false Figs. 4F uchl5-psmc2-1 Interactors of UCLH5 (UCH37) 832891 n/a 832908 unspecified role unspecified role prey prey n/a 832902 unspecified role unspecified role prey prey n/a 832909 unspecified role unspecified role prey prey n/a 832910 unspecified role unspecified role prey prey n/a 832911 unspecified role unspecified role prey prey n/a 832912 unspecified role unspecified role prey prey n/a 832913 unspecified role unspecified role prey prey n/a 832905 unspecified role unspecified role prey prey n/a 832904 unspecified role unspecified role prey prey n/a 832895 unspecified role unspecified role prey prey n/a 832914 unspecified role unspecified role prey prey n/a 832915 unspecified role unspecified role prey prey n/a 832901 unspecified role unspecified role prey prey n/a 832899 unspecified role unspecified role prey prey n/a 832897 unspecified role unspecified role prey prey n/a 832916 unspecified role unspecified role prey prey n/a 832907 unspecified role unspecified role prey prey n/a 832917 unspecified role unspecified role prey prey n/a 832918 unspecified role unspecified role prey prey n/a 832919 unspecified role unspecified role bait bait n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n/a 832896 unspecified role unspecified role prey prey n/a 832920 unspecified role unspecified role prey prey n/a 832921 unspecified role unspecified role prey prey n/a 832922 unspecified role unspecified role prey prey n/a 832923 unspecified role unspecified role prey prey n/a 832924 unspecified role unspecified role prey prey n/a 832925 unspecified role unspecified role prey prey n/a 832926 unspecified role unspecified role prey prey n/a 832927 unspecified role unspecified role prey prey n/a 832928 unspecified role unspecified role prey prey n/a 832929 unspecified role unspecified role prey prey n/a 832930 unspecified role unspecified role prey prey association association false false false Supplementary table 1 One protein, b1 (P28072), was listed as being identified by 0 peptides so has been excluded for the list. The participant EBI-743997(P43686) was duplicated. It is posssible that originally this interaction did contain more participants pointing to different Trembl proteins which have been merged to a single swissprot protein later. The participant EBI-603340(P49720) was duplicated. It is posssible that originally this interaction did contain more participants pointing to different Trembl proteins which have been merged to a single swissprot protein later. psmd10-psmc5-1 Interactors of PSMD10 (p28) 832891 n/a 832895 unspecified role unspecified role prey prey n/a 832897 unspecified role unspecified role prey prey n/a 832898 unspecified role unspecified role prey prey n/a 832896 unspecified role unspecified role bait bait n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false association association false false false Supp. Table 1 psmd10-psmc5-2 Interactors of PSMD10 (p28) 832891 n/a 832915 unspecified role unspecified role prey prey n/a 832906 unspecified role unspecified role prey prey n/a 832914 unspecified role unspecified role prey prey n/a 832905 unspecified role unspecified role prey prey n/a 832904 unspecified role unspecified role prey prey n/a 832897 unspecified role unspecified role prey prey n/a 832901 unspecified role unspecified role prey prey n/a 832909 unspecified role unspecified role prey prey n/a 832908 unspecified role unspecified role prey prey n/a 832896 unspecified role unspecified role bait bait c-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false n/a 832895 unspecified role unspecified role prey prey n/a 832898 unspecified role unspecified role prey prey n/a 832899 unspecified role unspecified role prey prey association association false false false Supp. Table 1 psmd5-psmc5-1 Interactors of PSMD5 (S5b) 832891 n/a 832906 unspecified role unspecified role prey prey n/a 832917 unspecified role unspecified role prey prey n/a 832914 unspecified role unspecified role prey prey n/a 832909 unspecified role unspecified role prey prey n/a 832905 unspecified role unspecified role prey prey n/a 832897 unspecified role unspecified role prey prey n/a 832899 unspecified role unspecified role prey prey n/a 832895 unspecified role unspecified role prey prey n/a 832900 unspecified role unspecified role bait bait n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n/a 832904 unspecified role unspecified role prey prey n/a 832901 unspecified role unspecified role prey prey n/a 832902 unspecified role unspecified role prey prey n/a 832908 unspecified role unspecified role prey prey n/a 832931 unspecified role unspecified role prey prey n/a 832911 unspecified role unspecified role prey prey n/a 832913 unspecified role unspecified role prey prey n/a 832916 unspecified role unspecified role prey prey n/a 832918 unspecified role unspecified role prey prey n/a 832907 unspecified role unspecified role prey prey association association false false false Supp. Table 1 psmd9-psmc6-1 Interactors of PSMD9 (p27) 832891 n/a 832904 unspecified role unspecified role prey prey n/a 832903 unspecified role unspecified role bait bait n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n/a 832905 unspecified role unspecified role prey prey association association false false false Supp. Table 1 psmd9-psmc6-2 Interactors of PSMD9 (p27) 832891 n/a 832903 unspecified role unspecified role bait bait c-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false n/a 832905 unspecified role unspecified role prey prey n/a 832904 unspecified role unspecified role prey prey association association false false false Supp. Table 1 psmc5-psmd2-5 Interactors of PSMC5 (Rpt6) in presence of p28 siRNA - fraction 22 832892 n/a 832901 unspecified role unspecified role prey prey n/a 832899 unspecified role unspecified role prey prey n/a 832905 unspecified role unspecified role prey prey n/a 832895 unspecified role unspecified role prey prey n/a 832906 unspecified role unspecified role prey prey n/a 832897 unspecified role unspecified role bait bait n/a 832902 unspecified role unspecified role prey prey n/a 832904 unspecified role unspecified role prey prey association association false false false Figs. 6D and 6F Cells pre-incubated with p28 (PSMD10) siRNA psmc5-psmd2-6 Interactors of PSMC5 (Rpt6) in presence of p28 siRNA - fraction 32 (26S proteasome) 832892 n/a 832917 unspecified role unspecified role prey prey n/a 832915 unspecified role unspecified role prey prey n/a 832901 unspecified role unspecified role prey prey n/a 832904 unspecified role unspecified role prey prey n/a 832895 unspecified role unspecified role prey prey n/a 832906 unspecified role unspecified role prey prey n/a 832899 unspecified role unspecified role prey prey n/a 832905 unspecified role unspecified role prey prey n/a 832902 unspecified role unspecified role prey prey n/a 832897 unspecified role unspecified role bait bait association association false false false Figs. 6D and 6F psmc5-psmd2-7 Interactors of PSMC5 (Rpt6) in presence of p27 siRNA - fraction 18 832892 n/a 832895 unspecified role unspecified role prey prey n/a 832897 unspecified role unspecified role bait bait n/a 832906 unspecified role unspecified role prey prey n/a 832901 unspecified role unspecified role prey prey n/a 832899 unspecified role unspecified role prey prey n/a 832902 unspecified role unspecified role prey prey association association false false false Figs. 6D and 6G Cells pre-incubated with p28 (PSMD10) siRNA psmc5-psmd2-8 Interactors of PSMC5 (Rpt6) in presence of p27 siRNA - fraction 32 (26S proteasome) 832892 n/a 832897 unspecified role unspecified role bait bait n/a 832902 unspecified role unspecified role prey prey n/a 832895 unspecified role unspecified role prey prey n/a 832905 unspecified role unspecified role prey prey n/a 832901 unspecified role unspecified role prey prey n/a 832904 unspecified role unspecified role prey prey n/a 832899 unspecified role unspecified role prey prey n/a 832906 unspecified role unspecified role prey prey association association false false false Figs. 6D and 6G psmc1-psmc6-2 Interaction between PSMC1 and PSMC6 832893 n/a 832901 unspecified role unspecified role neutral component neutral component n/a 832895 unspecified role unspecified role neutral component neutral component physical association physical association false false false Not present in fraction 18 in Rpt4/5/p28-knockdown cells. psmc4-psmc6-1 Interaction between PSMC4 and PSMC6 832893 n/a 832905 unspecified role unspecified role neutral component neutral component n/a 832895 unspecified role unspecified role neutral component neutral component physical association physical association false false false Fig. 5B psmc1-psmc6-1 Interaction between PSMC1 and PSMC6 832893 n/a 832905 unspecified role unspecified role neutral component neutral component n/a 832901 unspecified role unspecified role neutral component neutral component physical association physical association false false false Fig. 5C psma1-psmd2-1 20S proteasome 832894 n/a 832906 unspecified role unspecified role neutral component neutral component n/a 832901 unspecified role unspecified role neutral component neutral component n/a 832897 unspecified role unspecified role neutral component neutral component n/a 832927 unspecified role unspecified role neutral component neutral component n/a 832902 unspecified role unspecified role neutral component neutral component physical association physical association false false false Fig. 1A psma1-psmd2-2 26S proteasome 832894 n/a 832897 unspecified role unspecified role neutral component neutral component n/a 832902 unspecified role unspecified role neutral component neutral component n/a 832895 unspecified role unspecified role neutral component neutral component n/a 832905 unspecified role unspecified role neutral component neutral component n/a 832899 unspecified role unspecified role neutral component neutral component n/a 832901 unspecified role unspecified role neutral component neutral component n/a 832906 unspecified role unspecified role neutral component neutral component n/a 832927 unspecified role unspecified role neutral component neutral component n/a 832904 unspecified role unspecified role neutral component neutral component n/a 832917 unspecified role unspecified role neutral component neutral component physical association physical association false false false Fig. 1A