IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ ianari-2009-2 Proapoptotic function of the retinoblastoma tumor suppressor protein. human-t98g Human caucasian glioblastoma line T98G t98g Human Caucasian glioblastoma T98G ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Ianari A., Natale T., Calo E., Ferretti E., Alesse E., Screpanti I., Haigis K., Gulino A., Lees JA. Apoptosis - Interactions involving proteins with a function related to apoptosis jalees@mit.edu Cancer Cell (1535-6108) 2009 Only protein-protein interactions 7 imex curation Cancer - Interactions investigated in the context of cancer ianari-2009-5 Proapoptotic function of the retinoblastoma tumor suppressor protein. human-imr_90 Homo sapiens embryonic fetal lung fibroblast imr_90 human, Caucasian female 16 fetal weeks; Tissue: lung, embryonic fibroblast ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Ianari A., Natale T., Calo E., Ferretti E., Alesse E., Screpanti I., Haigis K., Gulino A., Lees JA. Apoptosis - Interactions involving proteins with a function related to apoptosis Human IMR-90 cells expressing the murine ecotropic receptor were used. PMID: 15741165 gives the source of the Adenovirus E1A protein as strain Ad5. jalees@mit.edu Cancer Cell (1535-6108) 2009 Only protein-protein interactions 7 imex curation Cancer - Interactions investigated in the context of cancer ianari-2009-4 Proapoptotic function of the retinoblastoma tumor suppressor protein. human-imr_90 Homo sapiens embryonic fetal lung fibroblast imr_90 human, Caucasian female 16 fetal weeks; Tissue: lung, embryonic fibroblast anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Ianari A., Natale T., Calo E., Ferretti E., Alesse E., Screpanti I., Haigis K., Gulino A., Lees JA. Apoptosis - Interactions involving proteins with a function related to apoptosis Human IMR-90 cells expressing the murine ecotropic receptor were used. PMID: 15741165 gives the source of the Adenovirus E1A protein as strain Ad5. jalees@mit.edu Cancer Cell (1535-6108) 2009 Only protein-protein interactions 7 imex curation Cancer - Interactions investigated in the context of cancer ianari-2009-1 Proapoptotic function of the retinoblastoma tumor suppressor protein. human-t98g Human caucasian glioblastoma line T98G t98g Human Caucasian glioblastoma T98G anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Ianari A., Natale T., Calo E., Ferretti E., Alesse E., Screpanti I., Haigis K., Gulino A., Lees JA. Apoptosis - Interactions involving proteins with a function related to apoptosis jalees@mit.edu Cancer Cell (1535-6108) 2009 Only protein-protein interactions 7 imex curation Cancer - Interactions investigated in the context of cancer ianari-2009-3 Proapoptotic function of the retinoblastoma tumor suppressor protein. human-t98g Human caucasian glioblastoma line T98G t98g Human Caucasian glioblastoma T98G ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Ianari A., Natale T., Calo E., Ferretti E., Alesse E., Screpanti I., Haigis K., Gulino A., Lees JA. Apoptosis - Interactions involving proteins with a function related to apoptosis reChIP using an antibody to acetyl-H4, a marker of transcriptional activation. jalees@mit.edu Cancer Cell (1535-6108) 2009 Only protein-protein interactions 7 imex curation Cancer - Interactions investigated in the context of cancer ianari-2009-6 Proapoptotic function of the retinoblastoma tumor suppressor protein. human-u2-os Human U2-OS osteosarcoma cell line u2-os U2-OS osteocaroma cell line Not in CAPRI and no primary literature reference anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Ianari A., Natale T., Calo E., Ferretti E., Alesse E., Screpanti I., Haigis K., Gulino A., Lees JA. Apoptosis - Interactions involving proteins with a function related to apoptosis Human IMR-90 cells expressing the murine ecotropic receptor were used. jalees@mit.edu Cancer Cell (1535-6108) 2009 Only protein-protein interactions 7 imex curation Cancer - Interactions investigated in the context of cancer casp7_human_gene Human CASP7 gene gene gene human Homo sapiens Human rb_human Retinoblastoma-associated protein pRb pp110 p105-Rb RB1 p110-RB1 protein protein human Homo sapiens Human MPPKTPRKTAATAAAAAAEPPAPPPPPPPEEDPEQDSGPEDLPLVRLEFEETEEPDFTALCQKLKIPDHVRERAWLTWEKVSSVDGVLGGYIQKKKELWGICIFIAAVDLDEMSFTFTELQKNIEISVHKFFNLLKEIDTSTKVDNAMSRLLKKYDVLFALFSKLERTCELIYLTQPSSSISTEINSALVLKVSWITFLLAKGEVLQMEDDLVISFQLMLCVLDYFIKLSPPMLLKEPYKTAVIPINGSPRTPRRGQNRSARIAKQLENDTRIIEVLCKEHECNIDEVKNVYFKNFIPFMNSLGLVTSNGLPEVENLSKRYEEIYLKNKDLDARLFLDHDKTLQTDSIDSFETQRTPRKSNLDEEVNVIPPHTPVRTVMNTIQQLMMILNSASDQPSENLISYFNNCTVNPKESILKRVKDIGYIFKEKFAKAVGQGCVEIGSQRYKLGVRLYYRVMESMLKSEEERLSIQNFSKLLNDNIFHMSLLACALEVVMATYSRSTSQNLDSGTDLSFPWILNVLNLKAFDFYKVIESFIKAEGNLTREMIKHLERCEHRIMESLAWLSDSPLFDLIKQSKDREGPTDHLESACPLNLPLQNNHTAADMYLSPVRSPKKKGSTTRVNSTANAETQATSAFQTQKPLKSTSLSLFYKKVYRLAYLRLNTLCERLLSEHPELEHIIWTLFQHTLQNEYELMRDRHLDQIMMCSMYGICKVKNIDLKFKIIVTAYKDLPHAVQETFKRVLIKEEEYDSIIVFYNSVFMQRLKTNILQYASTRPPTLSPIPHIPRSPYKFPSSPLRIPGGNIYISPLKSPYKISEGLPTPTKMTPRSRILVSIGESFGTSEKFQKINQMVCNSDRVLKRSAEGSNPPKPLKKLRFDIEGSDEADGSKHLPGESKFQQKLAEMTSTRTRMQKQKMNDSMDTSNKEEK tp73_human_gene Human TP73 gene gene gene human Homo sapiens Human ccna2_human_gene Human CCNA2 gene gene gene human Homo sapiens Human rpb1_human DNA-directed RNA polymerase II subunit RPB1 POLR2A DNA-directed RNA polymerase II subunit A DNA-directed RNA polymerase III largest subunit POLR2 RNA-directed RNA polymerase II subunit RPB1 protein protein human Homo sapiens Human MHGGGPPSGDSACPLRTIKRVQFGVLSPDELKRMSVTEGGIKYPETTEGGRPKLGGLMDPRQGVIERTGRCQTCAGNMTECPGHFGHIELAKPVFHVGFLVKTMKVLRCVCFFCSKLLVDSNNPKIKDILAKSKGQPKKRLTHVYDLCKGKNICEGGEEMDNKFGVEQPEGDEDLTKEKGHGGCGRYQPRIRRSGLELYAEWKHVNEDSQEKKILLSPERVHEIFKRISDEECFVLGMEPRYARPEWMIVTVLPVPPLSVRPAVVMQGSARNQDDLTHKLADIVKINNQLRRNEQNGAAAHVIAEDVKLLQFHVATMVDNELPGLPRAMQKSGRPLKSLKQRLKGKEGRVRGNLMGKRVDFSARTVITPDPNLSIDQVGVPRSIAANMTFAEIVTPFNIDRLQELVRRGNSQYPGAKYIIRDNGDRIDLRFHPKPSDLHLQTGYKVERHMCDGDIVIFNRQPTLHKMSMMGHRVRILPWSTFRLNLSVTTPYNADFDGDEMNLHLPQSLETRAEIQELAMVPRMIVTPQSNRPVMGIVQDTLTAVRKFTKRDVFLERGEVMNLLMFLSTWDGKVPQPAILKPRPLWTGKQIFSLIIPGHINCIRTHSTHPDDEDSGPYKHISPGDTKVVVENGELIMGILCKKSLGTSAGSLVHISYLEMGHDITRLFYSNIQTVINNWLLIEGHTIGIGDSIADSKTYQDIQNTIKKAKQDVIEVIEKAHNNELEPTPGNTLRQTFENQVNRILNDARDKTGSSAQKSLSEYNNFKSMVVSGAKGSKINISQVIAVVGQQNVEGKRIPFGFKHRTLPHFIKDDYGPESRGFVENSYLAGLTPTEFFFHAMGGREGLIDTAVKTAETGYIQRRLIKSMESVMVKYDATVRNSINQVVQLRYGEDGLAGESVEFQNLATLKPSNKAFEKKFRFDYTNERALRRTLQEDLVKDVLSNAHIQNELEREFERMREDREVLRVIFPTGDSKVVLPCNLLRMIWNAQKIFHINPRLPSDLHPIKVVEGVKELSKKLVIVNGDDPLSRQAQENATLLFNIHLRSTLCSRRMAEEFRLSGEAFDWLLGEIESKFNQAIAHPGEMVGALAAQSLGEPATQMTLNTFHYAGVSAKNVTLGVPRLKELINISKKPKTPSLTVFLLGQSARDAERAKDILCRLEHTTLRKVTANTAIYYDPNPQSTVVAEDQEWVNVYYEMPDFDVARISPWLLRVELDRKHMTDRKLTMEQIAEKINAGFGDDLNCIFNDDNAEKLVLRIRIMNSDENKMQEEEEVVDKMDDDVFLRCIESNMLTDMTLQGIEQISKVYMHLPQTDNKKKIIITEDGEFKALQEWILETDGVSLMRVLSEKDVDPVRTTSNDIVEIFTVLGIEAVRKALERELYHVISFDGSYVNYRHLALLCDTMTCRGHLMAITRHGVNRQDTGPLMKCSFEETVDVLMEAAAHGESDPMKGVSENIMLGQLAPAGTGCFDLLLDAEKCKYGMEIPTNIPGLGAAGPTGMFFGSAPSPMGGISPAMTPWNQGATPAYGAWSPSVGSGMTPGAAGFSPSAASDASGFSPGYSPAWSPTPGSPGSPGPSSPYIPSPGGAMSPSYSPTSPAYEPRSPGGYTPQSPSYSPTSPSYSPTSPSYSPTSPNYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPNYSPTSPNYTPTSPSYSPTSPSYSPTSPNYTPTSPNYSPTSPSYSPTSPSYSPTSPSYSPSSPRYTPQSPTYTPSSPSYSPSSPSYSPASPKYTPTSPSYSPSSPEYTPTSPKYSPTSPKYSPTSPKYSPTSPTYSPTTPKYSPTSPTYSPTSPVYTPTSPKYSPTSPTYSPTSPKYSPTSPTYSPTSPKGSTYSPTSPGYSPTSPTYSLTSPAISPDDSDEEN e2f1_human Transcription factor E2F1 Retinoblastoma-associated protein 1 Retinoblastoma-binding protein 3 PBR3 E2F1 RBBP3 pRB-binding protein E2F-1 protein protein human Homo sapiens Human MALAGAPAGGPCAPALEALLGAGALRLLDSSQIVIISAAQDASAPPAPTGPAAPAAGPCDPDLLLFATPQAPRPTPSAPRPALGRPPVKRRLDLETDHQYLAESSGPARGRGRHPGKGVKSPGEKSRYETSLNLTTKRFLELLSHSADGVVDLNWAAEVLKVQKRRIYDITNVLEGIQLIAKKSKNHIQWLGSHTTVGVGGRLEGLTQDLRQLQESEQQLDHLMNICTTQLRLLSEDTDSQRLAYVTCQDLRSIADPAEQMVMVIKAPPETQLQAVDSSENFQISLKSKQGPIDVFLCPEETVGGISPGKTPSQEVTSEEENRATDSATIVSPPPSSPPSSLTTDPSQSLLSLEQEPLLSRMGSLRAPVDEDRLSPLVAADSLLEHVREDFSGLLPEEFISLSPPHEALDYHFGLEEGEGIRDLFDCDFGDLTPLDF hdac1_human Histone deacetylase 1 HDAC1 RPD3L1 protein protein human Homo sapiens Human MAQTQGTRRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANAEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVASAVKLNKQQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAIFKPVMSKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGGGGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIKQRLFENLRMLPHAPGVQMQAIPEDAIPEESGDEDEDDPDKRISICSSDKRIACEEEFSDSEEEGEGGRKNSSNFKKAKRVKTEDEKEKDPEEKKEVTEEEKTKEEKPEAKGVKEEVKLA e1a_ade05 Early E1A protein Early E1A 32 kDa protein protein protein ade05 Human adenovirus C serotype 5 (HAdV-5) HAdV-5 Human adenovirus 5 MRHIICHGGVITEEMAASLLDQLIEEVLADNLPPPSHFEPPTLHELYDLDVTAPEDPNEEAVSQIFPDSVMLAVQEGIDLLTFPPAPGSPEPPHLSRQPEQPEQRALGPVSMPNLVPEVIDLTCHEAGFPPSDDEDEEGEEFVLDYVEHPGHGCRSCHYHRRNTGDPDIMCSLCYMRTCGMFVYSPVSEPEPEPEPEPEPARPTRRPKMAPAILRRPTSPVSRECNSSTDSCDSGPSNTPPEIHPVVPLCPIKPVAVRVGGRRQAVECIEDLLNEPGQPLDLSCKRPRP h4_human Histone H4 H4-16 H4C1 H4C11 H4C12 H4C13 H4C14 H4C15 H4C2 H4C3 H4C4 H4C5 H4C6 H4C8 H4C9 H4/A H4/B H4/C H4/D H4/E H4/G H4/H H4/I H4/J H4/K H4/M H4/N H4/O H4F2 H4FA H4FB H4FC H4FD H4FE H4FG H4FH H4FI H4FJ H4FK H4FM H4FN H4FO HIST1H4A HIST1H4B HIST1H4C HIST1H4D HIST1H4E HIST1H4F HIST1H4H HIST1H4I HIST1H4J HIST1H4K HIST1H4L HIST2H4 HIST2H4A HIST2H4B HIST4H4 protein protein human Homo sapiens Human MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG e2f3_human Transcription factor E2F3 E2F3 KIAA0075 protein protein human Homo sapiens Human MRKGIQPALEQYLVTAGGGEGAAVVAAAAAASMDKRALLASPGFAAAAAAAAAPGAYIQILTTNTSTTSCSSSLQSGAVAAGPLLPSAPGAEQTAGSLLYTTPHGPSSRAGLLQQPPALGRGGSGGGGGPPAKRRLELGESGHQYLSDGLKTPKGKGRAALRSPDSPKTPKSPSEKTRYDTSLGLLTKKFIQLLSQSPDGVLDLNKAAEVLKVQKRRIYDITNVLEGIHLIKKKSKNNVQWMGCSLSEDGGMLAQCQGLSKEVTELSQEEKKLDELIQSCTLDLKLLTEDSENQRLAYVTYQDIRKISGLKDQTVIVVKAPPETRLEVPDSIESLQIHLASTQGPIEVYLCPEETETHSPMKTNNQDHNGNIPKPASKDLASTNSGHSDCSVSMGNLSPLASPANLLQQTEDQIPSNLEGPFVNLLPPLLQEDYLLSLGEEEGISDLFDAYDLEKLPLVEDFMCS kat2b_human Histone acetyltransferase KAT2B P300/CBP-associated factor PCAF Lysine acetyltransferase 2B Histone acetyltransferase PCAF KAT2B Spermidine acetyltransferase KAT2B protein protein human Homo sapiens Human MSEAGGAGPGGCGAGAGAGAGPGALPPQPAALPPAPPQGSPCAAAAGGSGACGPATAVAAAGTAEGPGGGGSARIAVKKAQLRSAPRAKKLEKLGVYSACKAEESCKCNGWKNPNPSPTPPRADLQQIIVSLTESCRSCSHALAAHVSHLENVSEEEMNRLLGIVLDVEYLFTCVHKEEDADTKQVYFYLFKLLRKSILQRGKPVVEGSLEKKPPFEKPSIEQGVNNFVQYKFSHLPAKERQTIVELAKMFLNRINYWHLEAPSQRRLRSPNDDISGYKENYTRWLCYCNVPQFCDSLPRYETTQVFGRTLLRSVFTVMRRQLLEQARQEKDKLPLEKRTLILTHFPKFLSMLEEEVYSQNSPIWDQDFLSASSRTSQLGIQTVINPPPVAGTISYNSTSSSLEQPNAGSSSPACKASSGLEANPGEKRKMTDSHVLEEAKKPRVMGDIPMELINEVMSTITDPAAMLGPETNFLSAHSARDEAARLEERRGVIEFHVVGNSLNQKPNKKILMWLVGLQNVFSHQLPRMPKEYITRLVFDPKHKTLALIKDGRVIGGICFRMFPSQGFTEIVFCAVTSNEQVKGYGTHLMNHLKEYHIKHDILNFLTYADEYAIGYFKKQGFSKEIKIPKTKYVGYIKDYEGATLMGCELNPRIPYTEFSVIIKKQKEIIKKLIERKQAQIRKVYPGLSCFKDGVRQIPIESIPGIRETGWKPSGKEKSKEPRDPDQLYSTLKSILQQVKSHQSAWPFMEPVKRTEAPGYYEVIRFPMDLKTMSERLKNRYYVSKKLFMADLQRVFTNCKEYNPPESEYYKCANILEKFFFSKIKEAGLIDK casp7-rb1 875927 n/a 875933 unspecified role unspecified role prey prey n/a 875934 unspecified role unspecified role bait bait association association false false false Doxorubicin treatment induced the recruitment of pRB and other proteins to both cell-cycle and proapoptotic promoters, resulting in activation of Caspase 7 and p73, and the repression of Cyclin A2. doxorubicin Fig 2B, Fig S1 for quantitative analysis of results. tp73-rb1 875927 n/a 875935 unspecified role unspecified role prey prey n/a 875934 unspecified role unspecified role bait bait association association false false false doxorubicin Fig 2B, Fig S1 for quantitative analysis of results. cyca2-rb1 875927 n/a 875934 unspecified role unspecified role bait bait n/a 875936 unspecified role unspecified role prey prey association association false false false Doxorubicin treatment induced recruitment of pRB to both cell-cycle and proapoptotic promoters, resulting in activation of Caspase 7 and p73, and the repression of Cyclin A2. HDAC1 was also specifically recruited to the Cyclin A2 promoter after Doxorubicin treatment. doxorubicin Fig 2B, Fig S1 for quantitative analysis of results. casp7-rpb1 875927 n/a 875933 unspecified role unspecified role prey prey n/a 875937 unspecified role unspecified role bait bait association association false false false Doxorubicin treatment induced the recruitment of pRB and other proteins to both cell-cycle and proapoptotic promoters, resulting in activation of Caspase 7 and p73, and the repression of Cyclin A2. doxorubicin Fig 2B, Fig S1 for quantitative analysis of results. casp7-e2f1 875927 n/a 875933 unspecified role unspecified role prey prey n/a 875938 unspecified role unspecified role bait bait association association false false false Doxorubicin treatment induced the recruitment of pRB and other proteins to both cell-cycle and proapoptotic promoters, resulting in activation of Caspase 7 and p73, and the repression of Cyclin A2. doxorubicin Fig 2B, Fig S1 for quantitative analysis of results. Transcription factor E2F1 bound to the Caspase 7 promoter. tp73-rpb1 875927 n/a 875937 unspecified role unspecified role bait bait n/a 875935 unspecified role unspecified role prey prey association association false false false doxorubicin Fig 2B, Fig S1 for quantitative analysis of results. tp73-e2f1 875927 n/a 875938 unspecified role unspecified role bait bait n/a 875935 unspecified role unspecified role prey prey association association false false false doxorubicin Fig 2B, Fig S1 for quantitative analysis of results. cyca2-hdac1 875927 n/a 875939 unspecified role unspecified role bait bait n/a 875936 unspecified role unspecified role prey prey association association false false false Doxorubicin treatment induced recruitment of pRB to both cell-cycle and proapoptotic promoters, resulting in activation of Caspase 7 and p73, and the repression of Cyclin A2. HDAC1 was also specifically recruited to the Cyclin A2 promoter after Doxorubicin treatment. doxorubicin Fig 2B, Fig S1 for quantitative analysis of results. cyca2-e2f1 875927 n/a 875936 unspecified role unspecified role prey prey n/a 875938 unspecified role unspecified role bait bait association association false false false Doxorubicin treatment induced recruitment of pRB to both cell-cycle and proapoptotic promoters, resulting in activation of Caspase 7 and p73, and the repression of Cyclin A2. HDAC1 was also specifically recruited to the Cyclin A2 promoter after Doxorubicin treatment. doxorubicin Fig 2B, Fig S1 for quantitative analysis of results. cyca2-rpb1 875927 n/a 875936 unspecified role unspecified role prey prey n/a 875937 unspecified role unspecified role bait bait association association false false false Doxorubicin treatment induced recruitment of pRB to both cell-cycle and proapoptotic promoters, resulting in activation of Caspase 7 and p73, and the repression of Cyclin A2. HDAC1 was also specifically recruited to the Cyclin A2 promoter after Doxorubicin treatment. doxorubicin Fig 2B, Fig S1 for quantitative analysis of results. rb1-tp73 875928 n/a 875935 unspecified role unspecified role prey prey n/a 875934 unspecified role unspecified role bait bait association association false false false doxorubicin Fig 5E. pRB bound to the p73 and Cyclin A2 promoters in the presence and absence of E1A. e1a-ccna2 875928 n/a 875936 unspecified role unspecified role prey prey n/a 875940 unspecified role unspecified role bait bait association association false false false doxorubicin Fig 5E. E1A bound to the p73 and Cyclin A2 promoters. The 243 amino acid "S12" form of E1A was used, which shares conserved regions "1+2" with the full length (13S) form. This S12 protein may be "Isoform early E1A 26 kDa protein" (SwissProt P03255-2),which also has 243 amino acids. ef1-tp73-1 875928 n/a 875935 unspecified role unspecified role prey prey n/a 875938 unspecified role unspecified role bait bait association association false false false doxorubicin Fig 5E. E2F1 bound to the p73 and Cyclin A2 promoters. h4-tp73-2 875928 n/a 875935 unspecified role unspecified role prey prey n/a 875941 unspecified role unspecified role bait bait ach4 naclys N-acetylated L-lysine NAcLys undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false doxorubicin Fig 5E. Acetylated Histone H4 bound to the p73 and Cyclin A2 promoters. e1a-tp73-1 875928 n/a 875935 unspecified role unspecified role prey prey n/a 875940 unspecified role unspecified role bait bait association association false false false doxorubicin Fig 5E. E1A bound to the p73 and Cyclin A2 promoters. The 243 amino acid "S12" form of E1A was used, which shares conserved regions "1+2" with the full length (13S) form. This S12 protein may be "Isoform early E1A 26 kDa protein" (SwissProt P03255-2),which also has 243 amino acids. ef1-ccn2 875928 n/a 875936 unspecified role unspecified role prey prey n/a 875938 unspecified role unspecified role bait bait association association false false false doxorubicin Fig 5E. E2F1 bound to the p73 and Cyclin A2 promoters. rb1-ccn2 875928 n/a 875934 unspecified role unspecified role bait bait n/a 875936 unspecified role unspecified role prey prey association association false false false doxorubicin Fig 5E. pRB bound to the p73 and Cyclin A2 promoters in the presence and absence of E1A. h4-ccn2 875928 n/a 875941 unspecified role unspecified role bait bait ach4 naclys N-acetylated L-lysine NAcLys undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 875936 unspecified role unspecified role prey prey association association false false false doxorubicin Fig 5E. Acetylated Histone H4 bound to the p73 and Cyclin A2 promoters. rb1-e2f1-4 875929 n/a 875934 unspecified role unspecified role bait bait n/a 875938 unspecified role unspecified role prey prey physical association physical association false false false doxorubicin Fig 5A. rb1-e2f3 875929 n/a 875942 unspecified role unspecified role prey prey n/a 875934 unspecified role unspecified role bait bait n/a 875938 unspecified role unspecified role prey prey n/a 875940 unspecified role unspecified role prey prey physical association physical association false false false doxorubicin Fig 5B. The 243 amino acid "S12" form of E1A was used, which shares conserved regions "1+2" with the full length (13S) form. This S12 protein may be (SwissProt P03255-2) "Isoform early E1A 26 kDa protein" which also has 243 amino acids. rb1-e1a-1 875929 n/a 875934 unspecified role unspecified role prey prey n/a 875938 unspecified role unspecified role prey prey n/a 875940 unspecified role unspecified role bait bait association association false false false doxorubicin Fig 5C. The 243 amino acid "S12" form of E1A was used, which shares conserved regions "1+2" with the full length (13S) form. This S12 protein may be "Isoform early E1A 26 kDa protein" (SwissProt P03255-2),which also has 243 amino acids. rb1p-e2f1-6 875929 n/a 875934 unspecified role unspecified role bait bait region (possible) phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 875938 unspecified role unspecified role prey prey physical association physical association false false false Fig 5D. rb1-kat2b 875930 n/a 875938 unspecified role unspecified role prey prey n/a 875934 unspecified role unspecified role bait bait n/a 875943 unspecified role unspecified role prey prey physical association physical association false false false doxorubicin Fig 1A. rb1-e2f1-3 875930 n/a 875934 unspecified role unspecified role bait bait region (possible) phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 875938 unspecified role unspecified role prey prey physical association physical association false false false Using a phospho-specific pRB cocktail of antibodies to demonstrate that phosphorylated pRB can participate in the formation of a complex with E2F1 in arrested and proliferating cells. doxorubicin Fig 1D-F. Fig 1B shows cell cycle distribution (by FACS) of asynchronous T98G cells. casp7-rb1-h4 875931 n/a 875941 unspecified role unspecified role bait bait acetyl-h4 naclys N-acetylated L-lysine NAcLys undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 875933 unspecified role unspecified role prey prey n/a 875934 unspecified role unspecified role prey prey association association false false false doxorubicin Fig 2C. rb1-e2f1-6 875932 n/a 875934 unspecified role unspecified role bait bait n/a 875938 unspecified role unspecified role prey prey physical association physical association false false false doxorubicin, etoposide, camptothecin. Supplementary Material, Fig S2A.