IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ lopez_sanchez-2008-6 Plk3 interacts and specifically phosphorylates VRK1 in Ser342, a downstream target in a pathway that induces Golgi fragmentation. in vitro In vitro protein kinase assay protein kinase assay autoradiography autoradiography Lopez-Sanchez I, Sanz-Garcia M, and Lazo PA Apoptosis - Interactions involving proteins with a function related to apoptosis 2008-07-22: Lazo P, Instituto de Biologia Molecular y Celular del Cancer, Centro de Investigacion del Cancer, CSIC-Universidad de Salamanca, Campus Miguel de Unamuno, E-37007 Salamanca, Spain plazozbi@usal.es Only protein-protein interactions imex curation lopez_sanchez-2008-9 Plk3 interacts and specifically phosphorylates VRK1 in Ser342, a downstream target in a pathway that induces Golgi fragmentation. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. pull down pull down anti tag western anti tag western blot anti tag western Lopez-Sanchez I, Sanz-Garcia M, and Lazo PA Apoptosis - Interactions involving proteins with a function related to apoptosis 2008-07-22: Lazo P, Instituto de Biologia Molecular y Celular del Cancer, Centro de Investigacion del Cancer, CSIC-Universidad de Salamanca, Campus Miguel de Unamuno, E-37007 Salamanca, Spain plazozbi@usal.es Only protein-protein interactions imex curation lopez_sanchez-2008-3 Plk3 interacts and specifically phosphorylates VRK1 in Ser342, a downstream target in a pathway that induces Golgi fragmentation. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Lopez-Sanchez I, Sanz-Garcia M, and Lazo PA Apoptosis - Interactions involving proteins with a function related to apoptosis 2008-07-22: Lazo P, Instituto de Biologia Molecular y Celular del Cancer, Centro de Investigacion del Cancer, CSIC-Universidad de Salamanca, Campus Miguel de Unamuno, E-37007 Salamanca, Spain plazozbi@usal.es Only protein-protein interactions imex curation lopez_sanchez-2008-1 Plk3 interacts and specifically phosphorylates VRK1 in Ser342, a downstream target in a pathway that induces Golgi fragmentation. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. pull down pull down western blot western blot Immuno blot Immuno blot Lopez-Sanchez I, Sanz-Garcia M, and Lazo PA Apoptosis - Interactions involving proteins with a function related to apoptosis 2008-07-22: Lazo P, Instituto de Biologia Molecular y Celular del Cancer, Centro de Investigacion del Cancer, CSIC-Universidad de Salamanca, Campus Miguel de Unamuno, E-37007 Salamanca, Spain plazozbi@usal.es Only protein-protein interactions imex curation lopez_sanchez-2008-2 Plk3 interacts and specifically phosphorylates VRK1 in Ser342, a downstream target in a pathway that induces Golgi fragmentation. in vitro In vitro pull down pull down fingerprinting peptide massfingerprinting fingerprinting Lopez-Sanchez I, Sanz-Garcia M, and Lazo PA Apoptosis - Interactions involving proteins with a function related to apoptosis 2008-07-22: Lazo P, Instituto de Biologia Molecular y Celular del Cancer, Centro de Investigacion del Cancer, CSIC-Universidad de Salamanca, Campus Miguel de Unamuno, E-37007 Salamanca, Spain plazozbi@usal.es Only protein-protein interactions imex curation lopez_sanchez-2008-4 Plk3 interacts and specifically phosphorylates VRK1 in Ser342, a downstream target in a pathway that induces Golgi fragmentation. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. confocal microscopy confocal microscopy monoclonal immunost monoclonal antibody immunostaining monoclonal immunost Lopez-Sanchez I, Sanz-Garcia M, and Lazo PA Apoptosis - Interactions involving proteins with a function related to apoptosis 2008-07-22: Lazo P, Instituto de Biologia Molecular y Celular del Cancer, Centro de Investigacion del Cancer, CSIC-Universidad de Salamanca, Campus Miguel de Unamuno, E-37007 Salamanca, Spain plazozbi@usal.es Only protein-protein interactions imex curation lopez_sanchez-2008-5 Plk3 interacts and specifically phosphorylates VRK1 in Ser342, a downstream target in a pathway that induces Golgi fragmentation. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Lopez-Sanchez I, Sanz-Garcia M, and Lazo PA Apoptosis - Interactions involving proteins with a function related to apoptosis 2008-07-22: Lazo P, Instituto de Biologia Molecular y Celular del Cancer, Centro de Investigacion del Cancer, CSIC-Universidad de Salamanca, Campus Miguel de Unamuno, E-37007 Salamanca, Spain plazozbi@usal.es Only protein-protein interactions imex curation lopez_sanchez-2008-7 Plk3 interacts and specifically phosphorylates VRK1 in Ser342, a downstream target in a pathway that induces Golgi fragmentation. human-a_549 Homo sapiens Caucasian lung carcinoma cell line a_549 Human Caucasian lung carcinoma confocal microscopy confocal microscopy monoclonal immunost monoclonal antibody immunostaining monoclonal immunost Lopez-Sanchez I, Sanz-Garcia M, and Lazo PA Apoptosis - Interactions involving proteins with a function related to apoptosis 2008-07-22: Lazo P, Instituto de Biologia Molecular y Celular del Cancer, Centro de Investigacion del Cancer, CSIC-Universidad de Salamanca, Campus Miguel de Unamuno, E-37007 Salamanca, Spain plazozbi@usal.es Only protein-protein interactions imex curation lopez_sanchez-2008-8 Plk3 interacts and specifically phosphorylates VRK1 in Ser342, a downstream target in a pathway that induces Golgi fragmentation. human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 confocal microscopy confocal microscopy immunostaining immunostaining Lopez-Sanchez I, Sanz-Garcia M, and Lazo PA Apoptosis - Interactions involving proteins with a function related to apoptosis 2008-07-22: Lazo P, Instituto de Biologia Molecular y Celular del Cancer, Centro de Investigacion del Cancer, CSIC-Universidad de Salamanca, Campus Miguel de Unamuno, E-37007 Salamanca, Spain plazozbi@usal.es Only protein-protein interactions imex curation lopez_sanchez-2008-10 Plk3 interacts and specifically phosphorylates VRK1 in Ser342, a downstream target in a pathway that induces Golgi fragmentation. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Lopez-Sanchez I, Sanz-Garcia M, and Lazo PA Apoptosis - Interactions involving proteins with a function related to apoptosis 2008-07-22: Lazo P, Instituto de Biologia Molecular y Celular del Cancer, Centro de Investigacion del Cancer, CSIC-Universidad de Salamanca, Campus Miguel de Unamuno, E-37007 Salamanca, Spain plazozbi@usal.es Only protein-protein interactions imex curation atp ATP Adenosine 5'-triphosphate Adenosine triphosphate ADENOSINE-5'-TRIPHOSPHATE Adephos Adetol Adynol Atipi ATP Atriphos Cardenosine Fosfobion Glucobasin H4atp Myotriphos Triadenyl Triphosphaden adenosine 5'-(tetrahydrogen triphosphate) small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) vrk1_human Serine/threonine-protein kinase VRK1 Vaccinia-related kinase 1 VRK1 protein protein human Homo sapiens Human MPRVKAAQAGRQSSAKRHLAEQFAVGEIITDMAKKEWKVGLPIGQGGFGCIYLADMNSSESVGSDAPCVVKVEPSDNGPLFTELKFYQRAAKPEQIQKWIRTRKLKYLGVPKYWGSGLHDKNGKSYRFMIMDRFGSDLQKIYEANAKRFSRKTVLQLSLRILDILEYIHEHEYVHGDIKASNLLLNYKNPDQVYLVDYGLAYRYCPEGVHKEYKEDPKRCHDGTIEFTSIDAHNGVAPSRRGDLEILGYCMIQWLTGHLPWEDNLKDPKYVRDSKIRYRENIASLMDKCFPEKNKPGEIAKYMETVKLLDYTEKPLYENLRDILLQGLKAIGSKDDGKLDLSVVENGGLKAKTITKKRKKEIEESKEPGVEDTEWSNTQTEEAIQTRSRTRKRVQK plk3_human Serine/threonine-protein kinase PLK3 Polo-like kinase 3 Cytokine-inducible serine/threonine-protein kinase FGF-inducible kinase Proliferation-related kinase PLK3 CNK FNK PRK protein protein human Homo sapiens Human MEPAAGFLSPRPFQRAAAAPAPPAGPGPPPSALRGPELEMLAGLPTSDPGRLITDPRSGRTYLKGRLLGKGGFARCYEATDTETGSAYAVKVIPQSRVAKPHQREKILNEIELHRDLQHRHIVRFSHHFEDADNIYIFLELCSRKSLAHIWKARHTLLEPEVRYYLRQILSGLKYLHQRGILHRDLKLGNFFITENMELKVGDFGLAARLEPPEQRKKTICGTPNYVAPEVLLRQGHGPEADVWSLGCVMYTLLCGSPPFETADLKETYRCIKQVHYTLPASLSLPARQLLAAILRASPRDRPSIDQILRHDFFTKGYTPDRLPISSCVTVPDLTPPNPARSLFAKVTKSLFGRKKKSKNHAQERDEVSGLVSGLMRTSVGHQDARPEAPAASGPAPVSLVETAPEDSSPRGTLASSGDGFEEGLTVATVVESALCALRNCIAFMPPAEQNPAPLAQPEPLVWVSKWVDYSNKFGFGYQLSSRRVAVLFNDGTHMALSANRKTVHYNPTSTKHFSFSVGAVPRALQPQLGILRYFASYMEQHLMKGGDLPSVEEVEVPAPPLLLQWVKTDQALLMLFSDGTVQVNFYGDHTKLILSGWEPLLVTFVARNRSACTYLASHLRQLGCSPDLRQRLRYALRLLRDRSPA p53_mouse Cellular tumor antigen p53 Tp53 P53 Trp53 Tumor suppressor p53 protein protein mouse Mus musculus Mouse MTAMEESQSDISLELPLSQETFSGLWKLLPPEDILPSPHCMDDLLLPQDVEEFFEGPSEALRVSGAPAAQDPVTETPGPVAPAPATPWPLSSFVPSQKTYQGNYGFHLGFLQSGTAKSVMCTYSPPLNKLFCQLAKTCPVQLWVSATPPAGSRVRAMAIYKKSQHMTEVVRRCPHHERCSDGDGLAPPQHLIRVEGNLYPEYLEDRQTFRHSVVVPYEPPEAGSEYTTIHYKYMCNSSCMGGMNRRPILTIITLEDSSGNLLGRDSFEVRVCACPGRDRRTEEENFRKKEVLCPELPPGSAKRALPTCTSASPPQKKKPLDGEYFTLKIRGRKRFEMFRELNEALELKDAHATEESGDSRAHSSYLKTKKGQSTSRHKKTMVKKVGPDSD gogb1_human Golgin subfamily B member 1 Giantin Macrogolgin 372 kDa Golgi complex-associated protein GOLGB1 protein protein human Homo sapiens Human MLSRLSGLANVVLHELSGDDDTDQNMRAPLDPELHQESDMEFNNTTQEDVQERLAYAEQLVVELKDIIRQKDVQLQQKDEALQEERKAADNKIKKLKLHAKAKLTSLNKYIEEMKAQGGTVLPTEPQSEEQLSKHDKSSTEEEMEIEKIKHKLQEKEELISTLQAQLTQAQAEQPAQSSTEMEEFVMMKQQLQEKEEFISTLQAQLSQTQAEQAAQQVVREKDARFETQVRLHEDELLQLVTQADVETEMQQKLRVLQRKLEEHEESLVGRAQVVDLLQQELTAAEQRNQILSQQLQQMEAEHNTLRNTVETEREESKILLEKMELEVAERKLSFHNLQEEMHHLLEQFEQAGQAQAELESRYSALEQKHKAEMEEKTSHILSLQKTGQELQSACDALKDQNSKLLQDKNEQAVQSAQTIQQLEDQLQQKSKEISQFLNRLPLQQHETASQTSFPDVYNEGTQAVTEENIASLQKRVVELENEKGALLLSSIELEELKAENEKLSSQITLLEAQNRTGEADREVSEISIVDIANKRSSSAEESGQDVLENTFSQKHKELSVLLLEMKEAQEEIAFLKLQLQGKRAEEADHEVLDQKEMKQMEGEGIAPIKMKVFLEDTGQDFPLMPNEESSLPAVEKEQASTEHQSRTSEEISLNDAGVELKSTKQDGDKSLSAVPDIGQCHQDELERLKSQILELELNFHKAQEIYEKNLDEKAKEISNLNQLIEEFKKNADNNSSAFTALSEERDQLLSQVKELSMVTELRAQVKQLEMNLAEAERQRRLDYESQTAHDNLLTEQIHSLSIEAKSKDVKIEVLQNELDDVQLQFSEQSTLIRSLQSQLQNKESEVLEGAERVRHISSKVEELSQALSQKELEITKMDQLLLEKKRDVETLQQTIEEKDQQVTEISFSMTEKMVQLNEEKFSLGVEIKTLKEQLNLLSRAEEAKKEQVEEDNEVSSGLKQNYDEMSPAGQISKEELQHEFDLLKKENEQRKRKLQAALINRKELLQRVSRLEEELANLKDESKKEIPLSETERGEVEEDKENKEYSEKCVTSKCQEIEIYLKQTISEKEVELQHIRKDLEEKLAAEEQFQALVKQMNQTLQDKTNQIDLLQAEISENQAIIQKLITSNTDASDGDSVALVKETVVISPPCTGSSEHWKPELEEKILALEKEKEQLQKKLQEALTSRKAILKKAQEKERHLREELKQQKDDYNRLQEQFDEQSKENENIGDQLRQLQIQVRESIDGKLPSTDQQESCSSTPGLEEPLFKATEQHHTQPVLESNLCPDWPSHSEDASALQGGTSVAQIKAQLKEIEAEKVELELKVSSTTSELTKKSEEVFQLQEQINKQGLEIESLKTVSHEAEVHAESLQQKLESSQLQIAGLEHLRELQPKLDELQKLISKKEEDVSYLSGQLSEKEAALTKIQTEIIEQEDLIKALHTQLEMQAKEHDERIKQLQVELCEMKQKPEEIGEESRAKQQIQRKLQAALISRKEALKENKSLQEELSLARGTIERLTKSLADVESQVSAQNKEKDTVLGRLALLQEERDKLITEMDRSLLENQSLSSSCESLKLALEGLTEDKEKLVKEIESLKSSKIAESTEWQEKHKELQKEYEILLQSYENVSNEAERIQHVVEAVRQEKQELYGKLRSTEANKKETEKQLQEAEQEMEEMKEKMRKFAKSKQQKILELEEENDRLRAEVHPAGDTAKECMETLLSSNASMKEELERVKMEYETLSKKFQSLMSEKDSLSEEVQDLKHQIEGNVSKQANLEATEKHDNQTNVTEEGTQSIPGETEEQDSLSMSTRPTCSESVPSAKSANPAVSKDFSSHDEINNYLQQIDQLKERIAGLEEEKQKNKEFSQTLENEKNTLLSQISTKDGELKMLQEEVTKMNLLNQQIQEELSRVTKLKETAEEEKDDLEERLMNQLAELNGSIGNYCQDVTDAQIKNELLESEMKNLKKCVSELEEEKQQLVKEKTKVESEIRKEYLEKIQGAQKEPGNKSHAKELQELLKEKQQEVKQLQKDCIRYQEKISALERTVKALEFVQTESQKDLEITKENLAQAVEHRKKAQAELASFKVLLDDTQSEAARVLADNLKLKKELQSNKESVKSQMKQKDEDLERRLEQAEEKHLKEKKNMQEKLDALRREKVHLEETIGEIQVTLNKKDKEVQQLQENLDSTVTQLAAFTKSMSSLQDDRDRVIDEAKKWERKFSDAIQSKEEEIRLKEDNCSVLKDQLRQMSIHMEELKINISRLEHDKQIWESKAQTEVQLQQKVCDTLQGENKELLSQLEETRHLYHSSQNELAKLESELKSLKDQLTDLSNSLEKCKEQKGNLEGIIRQQEADIQNSKFSYEQLETDLQASRELTSRLHEEINMKEQKIISLLSGKEEAIQVAIAELRQQHDKEIKELENLLSQEEEENIVLEEENKKAVDKTNQLMETLKTIKKENIQQKAQLDSFVKSMSSLQNDRDRIVGDYQQLEERHLSIILEKDQLIQEAAAENNKLKEEIRGLRSHMDDLNSENAKLDAELIQYREDLNQVITIKDSQQKQLLEVQLQQNKELENKYAKLEEKLKESEEANEDLRRSFNALQEEKQDLSKEIESLKVSISQLTRQVTALQEEGTLGLYHAQLKVKEEEVHRLSALFSSSQKRIAELEEELVCVQKEAAKKVGEIEDKLKKELKHLHHDAGIMRNETETAEERVAELARDLVEMEQKLLMVTKENKGLTAQIQSFGRSMSSLQNSRDHANEELDELKRKYDASLKELAQLKEQGLLNRERDALLSETAFSMNSTEENSLSHLEKLNQQLLSKDEQLLHLSSQLEDSYNQVQSFSKAMASLQNERDHLWNELEKFRKSEEGKQRSAAQPSTSPAEVQSLKKAMSSLQNDRDRLLKELKNLQQQYLQINQEITELHPLKAQLQEYQDKTKAFQIMQEELRQENLSWQHELHQLRMEKSSWEIHERRMKEQYLMAISDKDQQLSHLQNLIRELRSSSSQTQPLKVQYQRQASPETSASPDGSQNLVYETELLRTQLNDSLKEIHQKELRIQQLNSNFSQLLEEKNTLSIQLCDTSQSLRENQQHYGDLLNHCAVLEKQVQELQAGPLNIDVAPGAPQEKNGVHRKSDPEELREPQQSFSEAQQQLCNTRQEVNELRKLLEEERDQRVAAENALSVAEEQIRRLEHSEWDSSRTPIIGSCGTQEQALLIDLTSNSCRRTRSGVGWKRVLRSLCHSRTRVPLLAAIYFLMIHVLLILCFTGHL vrk1-plk3-5 758076 n/a 758086 enzyme target enzyme target substrate substrate unspecified role unspecified role n/a 758087 enzyme target enzyme target substrate substrate unspecified role unspecified role Q99986:p.Lys179Glu mutation mutation certain certain sequence position certain certain certain sequence position certain false region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) n/a 758088 enzyme enzyme unspecified role unspecified role region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. phosphorylation phosphorylation reaction phosphorylation false false false 1d Kinase dead VRK1 was used to show this interaction. PLK3 and VRK1 are both phosphorylated vrk1-plk3-6 758076 n/a 758088 enzyme enzyme unspecified role unspecified role region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) n/a 758087 enzyme target enzyme target substrate substrate unspecified role unspecified role Q99986:p.Lys179Glu mutation mutation certain certain sequence position certain certain certain sequence position certain false region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Q99986:p.Ser342Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) n/a 758086 enzyme target enzyme target substrate substrate unspecified role unspecified role phosphorylation phosphorylation reaction phosphorylation false false false 1b Kinase dead VRK1 was used to show this interaction. PLK3 and VRK1 are both phosphorylated vrk1-2 758076 n/a 758086 enzyme target enzyme target substrate substrate unspecified role unspecified role n/a 758087 putative self putative self unspecified role unspecified role region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) phosphorylation phosphorylation reaction phosphorylation false false false 1c VRK1 is phosphorylated plk3-1 758076 n/a 758088 putative self putative self unspecified role unspecified role Q9H4B4:p.Lys91Arg mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) n/a 758086 enzyme target enzyme target substrate substrate unspecified role unspecified role phosphorylation phosphorylation reaction phosphorylation false false false 1b PLK3 is phosphorylated vrk1-1 758076 n/a 758086 enzyme target enzyme target substrate substrate unspecified role unspecified role n/a 758087 putative self putative self unspecified role unspecified role Q99986:p.Lys179Glu mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) phosphorylation phosphorylation reaction phosphorylation false false false 1b VRK1 is phosphorylated vrk1-p53-3 758076 n/a 758087 enzyme enzyme unspecified role unspecified role region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) n/a 758089 enzyme target enzyme target substrate substrate unspecified role unspecified role region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false 4-88 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false The range was 1-85 but UniProt updated sequence so now range is 4-88. ecoli Escherichia coli (strain K12) n/a 758086 enzyme target enzyme target substrate substrate unspecified role unspecified role phosphorylation phosphorylation reaction phosphorylation false false false 1c VRK1 and p53 are phosphorylated plk3-vrk1 758077 n/a 758087 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Q99986:p.Lys179Glu mutation mutation certain certain sequence position certain certain certain sequence position certain false Q99986:p.Ser342Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false n/a 758088 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Q9H4B4:p.Lys91Arg mutation mutation certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false 3b VRK1 interacted with active and inactive PLK3. Inactive VRK1 lys179glu interacted with inactive PLK3 lys52arg. plk3-vrk1-4 758077 n/a 758087 unspecified role unspecified role bait bait region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 758088 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 4a plk3-vrk1-5 758077 n/a 758088 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 758087 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false 4b,4c vrk1-plk3-2 758078 N/A 758088 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 758087 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 3a transfection vrk1-plk3-8 758078 n/a 758088 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 758087 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 3a transfection plk3-vrk1-1 758079 n/a 758087 unspecified role unspecified role prey prey n/a 758088 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Q9H4B4:p.Lys91Arg mutation mutation certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false 3 Transfection of bait plk3-vrk1-2 758079 n/a 758088 unspecified role unspecified role prey prey n/a 758087 unspecified role unspecified role bait bait physical association physical association false false false 3d Transfection of bait vrk1-plk3-1 758080 N/A 758088 unspecified role unspecified role prey prey region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false N/A 758087 unspecified role unspecified role bait bait physical association physical association false false false S2 vrk1-plk3-3 758081 N/A 758088 unspecified role unspecified role neutral component neutral component region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 758087 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false 2C vrk1-plk3-4 758082 N/A 758088 unspecified role unspecified role prey prey N/A 758087 unspecified role unspecified role bait bait physical association physical association false false false 2B vrk1-plk3-7 758083 n/a 758087 unspecified role unspecified role neutral component neutral component n/a 758088 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false 2D vrk1-giantin 758084 n/a 758090 unspecified role unspecified role neutral component neutral component n/a 758087 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false 5 In interphase and late telophase cells, VRK1 and giantin colocalized in a compacted body, but in intermediate steps along the progression of mitosis they retained their colocalization into smaller golgi vesicles. vrk1-plk3-9 758085 n/a 758087 unspecified role unspecified role bait bait Q99986:p.Lys179Glu mutation mutation certain certain sequence position certain certain certain sequence position certain false region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) n/a 758088 unspecified role unspecified role prey prey region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false S1b