IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ nagano-2008-2 Functional association of cell death suppressor, Arabidopsis Bax Inhibitor-1, with fatty acid 2-hydroxylation through cytochrome b. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast ub reconstruction ubiquitin reconstruction ub reconstruction predetermined predetermined participant predetermined Nagano M., Ihara-Ohori Y., Imai H., Inada N., Fujimoto M., Tsutsumi N., Uchimiya H., Kawai-Yamada M. Apoptosis - Interactions involving proteins with a function related to apoptosis Plasmid DNA was introduced into onion epidermal cells by particle bombardment. mkawai@mail.saitama-u.ac.jp Arabidopsis cDNA library. Plant J. (0960-7412) 2008 Only protein-protein interactions imex curation nagano-2008-4 Functional association of cell death suppressor, Arabidopsis Bax Inhibitor-1, with fatty acid 2-hydroxylation through cytochrome b. allce Allium cepa (Onion) Onion confocal microscopy confocal microscopy tag fluorescence tag visualisation by fluorescence tag fluorescence Nagano M., Ihara-Ohori Y., Imai H., Inada N., Fujimoto M., Tsutsumi N., Uchimiya H., Kawai-Yamada M. Apoptosis - Interactions involving proteins with a function related to apoptosis Plasmid DNA was introduced into onion epidermal cells by particle bombardment. mkawai@mail.saitama-u.ac.jp Arabidopsis cDNA library. Plant J. (0960-7412) 2008 Only protein-protein interactions imex curation nagano-2008-5 Functional association of cell death suppressor, Arabidopsis Bax Inhibitor-1, with fatty acid 2-hydroxylation through cytochrome b. allce Allium cepa (Onion) Onion fret fluorescent resonance energy transfer FRET RET FRET analysis FRET RET FRET analysis fret tag fluorescence tag visualisation by fluorescence tag fluorescence Nagano M., Ihara-Ohori Y., Imai H., Inada N., Fujimoto M., Tsutsumi N., Uchimiya H., Kawai-Yamada M. Apoptosis - Interactions involving proteins with a function related to apoptosis Plasmid DNA was introduced into onion epidermal cells by particle bombardment. mkawai@mail.saitama-u.ac.jp Arabidopsis cDNA library. Plant J. (0960-7412) 2008 Only protein-protein interactions imex curation nagano-2008-1 Functional association of cell death suppressor, Arabidopsis Bax Inhibitor-1, with fatty acid 2-hydroxylation through cytochrome b. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast ub reconstruction ubiquitin reconstruction ub reconstruction nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Nagano M., Ihara-Ohori Y., Imai H., Inada N., Fujimoto M., Tsutsumi N., Uchimiya H., Kawai-Yamada M. Apoptosis - Interactions involving proteins with a function related to apoptosis Plasmid DNA was introduced into onion epidermal cells by particle bombardment. mkawai@mail.saitama-u.ac.jp Arabidopsis cDNA library. Plant J. (0960-7412) 2008 Only protein-protein interactions imex curation nagano-2008-3 Functional association of cell death suppressor, Arabidopsis Bax Inhibitor-1, with fatty acid 2-hydroxylation through cytochrome b. nicbe Nicotiana benthamiana bifc bimolecular fluorescence complementation bifc tag fluorescence tag visualisation by fluorescence tag fluorescence Nagano M., Ihara-Ohori Y., Imai H., Inada N., Fujimoto M., Tsutsumi N., Uchimiya H., Kawai-Yamada M. Apoptosis - Interactions involving proteins with a function related to apoptosis Plasmid DNA was introduced into onion epidermal cells by particle bombardment. mkawai@mail.saitama-u.ac.jp Arabidopsis cDNA library. Plant J. (0960-7412) 2008 Only protein-protein interactions imex curation cyb5b_arath Cytochrome b5 isoform B CYTB5-B CB5-E Cytochrome b5 isoform 2 Cytochrome b5 isoform E F24L7.14 At2g32720 CB5-B protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MGDEAKIFTLSEVSEHNQAHDCWIVINGKVYNVTKFLEDHPGGDDVLLSSTGKDATDDFEDVGHSESAREMMEQYYVGEIDPTTIPKKVKYTPPKQPHYNQDKTSEFIIKLLQFLVPLAILGLAVGIRIYTKSG bi1_arath Bax inhibitor 1 BI-1 K14A3.7 At5g47120 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MDAFSSFFDSQPGSRSWSYDSLKNFRQISPAVQNHLKRVYLTLCCALVASAFGAYLHVLWNIGGILTTIGCIGTMIWLLSCPPYEHQKRLSLLFVSAVLEGASVGPLIKVAIDVDPSILITAFVGTAIAFVCFSAAAMLARRREYLYLGGLLSSGLSMLMWLQFASSIFGGSASIFKFELYFGLLIFVGYMVVDTQEIIEKAHLGDMDYVKHSLTLFTDFVAVFVRILIIMLKNSADKEEKKKKRRN cyb5a_arath Cytochrome b5 isoform A CB5-D Cytochrome b5 isoform D F28B23.1 T1K7.28 At1g26340 CB5-A protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MPTLTKLYSMEEAATHNKQDDCWVVIDGKVYDVSSYMDEHPGGDDVLLAVAGKDATDDFEDAGHSKDARELMEKYFIGELDESSLPEIPELKIYKKDQPQDSVQKLFDLTKQYWVVPVSIITISVAVSVLFSRKT cyb5c_arath Cytochrome B5 isoform C CYTB5-C CB5-C T3A4.3 At2g46650 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MANLISFHDVAKHKCKNDCWILIHGKVYDISTFMDEHPGGDNVLLAVTGKDASIDFEDVNHSKDAKELMKKYCIGDVDQSTVPVTQQYIPPWEKESTAAETTKEESGKKLLIYLIPLLILGVAFALRFYNNK cyb5d_arath Cytochrome B5 isoform D CYTB5-D B5-B CB5-B CB5-D Cytochrome b5 isoform B K24G6.14 At5g48810 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MGGDGKVFTLSEVSQHSSAKDCWIVIDGKVYDVTKFLDDHPGGDEVILTSTGKDATDDFEDVGHSSTAKAMLDEYYVGDIDTATVPVKAKFVPPTSTKAVATQDKSSDFVIKLLQFLVPLLILGLAFGIRYYTKTKAPSS cyb5e_arath Cytochrome b5 isoform E CYTB5-E B5-A CB5-A CB5-E Cytochrome b5 isoform 1 Cytochrome b5 isoform A MNC6.10 At5g53560 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSSDRKVLSFEEVSKHNKTKDCWLIISGKVYDVTPFMDDHPGGDEVLLSSTGKDATNDFEDVGHSDTARDMMDKYFIGEIDSSSVPATRTYVAPQQPAYNQDKTPEFIIKILQFLVPILILGLALVVRHYTKKD fah1_arath Dihydroceramide fatty acyl 2-hydroxylase FAH1 FAH1 Fatty acid 2-hydroxylase 1 T29F13.2 At2g34770 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MVAQGFTVDLKKPLVFQVGHLGEDYEEWVHQPIATKEGPRFFQSDFWEFLTLTVWWAVPVIWLPVVVWCISRSVSMGCSLPEIVPIVVMGIFIWTFFEYVLHRFVFHIKTKSYWGNTAHYLIHGCHHKHPMDHLRLVFPPTATAILCFPFWNIAKAISTPSTAPALFGGGMLGYVMYDVTHYYLHHAQPTRPVTKNLKKYHLNHHFRIQDKGFGITSSLWDIVFGTLPTTKAPRKEQ fah2_arath Dihydroceramide fatty acyl 2-hydroxylase FAH2 FAH2 Fatty acid 2-hydroxylase 2 T13K14.30 At4g20870 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MVAERYTVDLNKPLVFQVGHLGEEYQEWIHQPIVCVEGPRFFESDFWEFLTRTVWWAIPTIWLPVVCYVLSISASKGLTFPQIGLIVAFGVLTWTLLEYTLHRFLFHIQTKSYWANTAHYLLHGCHHKHPQDGLRLVFPPTATAILLVPLWKLLHLLATPATAPAILGGILFGYVMYDITHYYLHHGQPKEPTFKHLKKYHLNHHFRIQDKGYGITSSLWDKVFGTLPGIKAAAKKS bl_1-cb5b-1 Arabidopsis Bax inhibitor 1 interacts with Cb5B 803087 n/a 803092 unspecified role unspecified role prey prey n-terminal required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false n/a 803093 unspecified role unspecified role bait bait physical association physical association false false false Details of the Bax inhibitor 1 bait protein were obtained from a reference provided in the text. Figure 2d bl_1-cb5a Arabidopsis Bax inhibitor 1 interacts with Cb5A 803087 n/a 803094 unspecified role unspecified role prey prey n/a 803093 unspecified role unspecified role bait bait physical association physical association false false false Details of the Bax inhibitor 1 bait protein were obtained from a reference provided in the text. Figure 2b bl_1-cb5c Arabidopsis Bax inhibitor 1 interacts with Cb5C 803087 n/a 803093 unspecified role unspecified role bait bait n/a 803095 unspecified role unspecified role prey prey physical association physical association false false false Details of the Bax inhibitor 1 bait protein were obtained from a reference provided in the text. Figure 2b bl_1-cb5d Arabidopsis Bax inhibitor 1 interacts with Cb5D 803087 n/a 803096 unspecified role unspecified role prey prey n/a 803093 unspecified role unspecified role bait bait physical association physical association false false false Details of the Bax inhibitor 1 bait protein were obtained from a reference provided in the text. Figure 2b bl_1-cb5e Arabidopsis Bax inhibitor 1 interacts with Cb5E 803087 n/a 803097 unspecified role unspecified role prey prey n/a 803093 unspecified role unspecified role bait bait physical association physical association false false false Details of the Bax inhibitor 1 bait protein were obtained from a reference provided in the text. Figure 2b fah1-cb5b Arabidopsis FAH1 with Cb5B 803087 n/a 803092 unspecified role unspecified role prey prey n/a 803098 unspecified role unspecified role bait bait physical association physical association false false false Figure 6b fah2-cb5b Arabidopsis FAH2 with Cb5B 803087 n/a 803092 unspecified role unspecified role prey prey n/a 803099 unspecified role unspecified role bait bait physical association physical association false false false Figure 6b bl_1-cb5b-3 Arabidopsis Bax inhibitor 1 interacts with Cb5B 803088 n/a 803092 unspecified role unspecified role neutral component neutral component region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 803093 unspecified role unspecified role neutral component neutral component region cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false Figure 3h fah2-cb5b-5 FAH2 interacts with Cb5B 803088 n/a 803092 unspecified role unspecified role neutral component neutral component region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 803099 unspecified role unspecified role neutral component neutral component region cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false Figure 7a bl_1-cb5b-4 Arabidopsis Bax inhibitor 1 interacts with Cb5B 803089 n/a 803092 unspecified role unspecified role neutral component neutral component region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 803093 unspecified role unspecified role neutral component neutral component region cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false proximity proximity close-contact colocalization neighbourhood interaction false false false Figure 3j fah2-cb5b-6 FAH2 interacts with Cb5B 803089 n/a 803099 unspecified role unspecified role neutral component neutral component region cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 803092 unspecified role unspecified role neutral component neutral component region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false proximity proximity close-contact colocalization neighbourhood interaction false false false Figure 7c bl_1-cb5b Arabidopsis Bax inhibitor 1 interacts with Cb5B 803090 n/a 803092 unspecified role unspecified role prey prey n/a 803093 unspecified role unspecified role bait bait physical association physical association false false false Details of the Bax inhibitor 1 bait protein were obtained from a reference provided in the text. bl_1-cb5b-2 Arabidopsis Bax inhibitor 1 interacts with Cb5B 803091 n/a 803093 unspecified role unspecified role neutral component neutral component c-terminal C terminal YFP yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false c-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false n/a 803092 unspecified role unspecified role neutral component neutral component n-terminal required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false c-terminal N-terminal YFP yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false c-terminal myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false Figure 3a to Figure 3g inclusive