UniProt UniProt http://www.uniprot.org liu-2008f-5 Macrophage Migration Inhibitory Factor (MIF) Interacts with Bim and Inhibits Bim-mediated Apoptosis. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Liu L., Chen J., Ji C., Zhang J., Sun J., Li Y., Xie Y., Gu S., Mao Y. Apoptosis - Interactions involving proteins with a function related to apoptosis shaohuaghu@fudan.edu.cn human fetal brain cDNA Mol. Cells (1016-8478) 2008 Only protein-protein interactions imex curation liu-2008f-4 Macrophage Migration Inhibitory Factor (MIF) Interacts with Bim and Inhibits Bim-mediated Apoptosis. human-k_562 Homo sapiens myeloid leukemia cells. k562 Myelogenous leukemia K562 cells anti bait coip anti bait coimmunoprecipitation anti bait coip antibody detection identification by antibody antibody detection Liu L., Chen J., Ji C., Zhang J., Sun J., Li Y., Xie Y., Gu S., Mao Y. Apoptosis - Interactions involving proteins with a function related to apoptosis Normal or diamide-treated (apoptotic) K562 cells have been used. shaohuaghu@fudan.edu.cn human fetal brain cDNA Mol. Cells (1016-8478) 2008 Only protein-protein interactions imex curation liu-2008f-1 Macrophage Migration Inhibitory Factor (MIF) Interacts with Bim and Inhibits Bim-mediated Apoptosis. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Liu L., Chen J., Ji C., Zhang J., Sun J., Li Y., Xie Y., Gu S., Mao Y. Apoptosis - Interactions involving proteins with a function related to apoptosis shaohuaghu@fudan.edu.cn human fetal brain cDNA Mol. Cells (1016-8478) 2008 Only protein-protein interactions imex curation liu-2008f-2 Macrophage Migration Inhibitory Factor (MIF) Interacts with Bim and Inhibits Bim-mediated Apoptosis. in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Liu L., Chen J., Ji C., Zhang J., Sun J., Li Y., Xie Y., Gu S., Mao Y. Apoptosis - Interactions involving proteins with a function related to apoptosis shaohuaghu@fudan.edu.cn human fetal brain cDNA Mol. Cells (1016-8478) 2008 Only protein-protein interactions imex curation liu-2008f-3 Macrophage Migration Inhibitory Factor (MIF) Interacts with Bim and Inhibits Bim-mediated Apoptosis. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti bait coip anti bait coimmunoprecipitation anti bait coip antibody detection identification by antibody antibody detection Liu L., Chen J., Ji C., Zhang J., Sun J., Li Y., Xie Y., Gu S., Mao Y. Apoptosis - Interactions involving proteins with a function related to apoptosis shaohuaghu@fudan.edu.cn human fetal brain cDNA Mol. Cells (1016-8478) 2008 Only protein-protein interactions imex curation mif_human Macrophage migration inhibitory factor MIF MMIF GLIF Phenylpyruvate tautomerase Glycosylation-inhibiting factor L-dopachrome tautomerase L-dopachrome isomerase protein protein human Homo sapiens Human MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA o43521-2 Bcl-2-like protein 11 Bim(L) BCL2L11 BIM Bcl2-interacting mediator of cell death protein protein human Homo sapiens Human MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQAEPADMRPEIWIAQELRRIGDEFNAYYARRVFLNNYQAAEDHPRMVILRLLRYIVRLVWRMH o54918-3 Bcl-2-like protein 11 Bcl2l11 Bim Bcl2-interacting mediator of cell death protein protein mouse Mus musculus Mouse MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEPQASIRQSQEEPEDLRPEIRIAQELRRIGDEFNETYTRRVFANDYREAEDHPQMVILQLLRFIFRLVWRRH o43521-5 Bcl-2-like protein 11 BCL2L11 BIM Bcl2-interacting mediator of cell death Bim-ACD BimACD protein protein human Homo sapiens Human MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQAEPADMRPEIWIAQELRRIGDEFNAYYARRLEK o43521-6 Bcl-2-like protein 11 BCL2-like 11 transcript variant 10 BCL2L11 BIM Bcl2-interacting mediator of cell death Bim-AD BimAD protein protein human Homo sapiens Human MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQASMRQAEPADMRPEIWIAQELRRIGDEFNAYYARRLEK o43521-1 Bcl-2-like protein 11 Bim(EL) BCL2L11 BIM Bcl2-interacting mediator of cell death protein protein human Homo sapiens Human MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQAEPADMRPEIWIAQELRRIGDEFNAYYARRVFLNNYQAAEDHPRMVILRLLRYIVRLVWRMH o43521-3 Bcl-2-like protein 11 Bim(S) BCL2-like 11 transcript variant 9 BCL2L11 BIM Bcl2-interacting mediator of cell death protein protein human Homo sapiens Human MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQASMRQAEPADMRPEIWIAQELRRIGDEFNAYYARRVFLNNYQAAEDHPRMVILRLLRYIVRLVWRMH bcl2ll1-mif-1 764356 n/a 764361 unspecified role unspecified role prey prey n/a 764362 unspecified role unspecified role bait bait physical association physical association false false false 1A bcl2ll1-mif-2 764356 n/a 764361 unspecified role unspecified role prey prey n/a 764363 unspecified role unspecified role bait bait physical association physical association false false false 1A bcl2ll1-mif-3 764356 n/a 764364 unspecified role unspecified role bait bait n/a 764361 unspecified role unspecified role prey prey physical association physical association false false false 1A bcl2ll1-mif-4 764356 n/a 764365 unspecified role unspecified role bait bait n/a 764361 unspecified role unspecified role prey prey physical association physical association false false false 1A The interaction has been shown to be weak/unstable. mif-biml-2 764357 N/A-x-x 764361 unspecified role unspecified role bait bait N/A-x-x 764362 unspecified role unspecified role prey prey physical association physical association false false false 2B Several Bim isoforms could be immunoprecipated but the identity of the isoforms cannot be unambigously established with the goat anti-Bim (N20) antibody used for immunoblotting. The authors refer to isoform (BimL O43521-2) (the most prominent coimmunoprecipitated form), isoform BimEL (O43521-1) and isoform BimS (O43521-3). The curation tentatively followed the authors statement. The interaction was increased in apoptotic cells. mif-biml-3 764357 n/a 764366 unspecified role unspecified role prey prey n/a-x-x 764361 unspecified role unspecified role bait bait physical association physical association false false false 2B Several Bim isoforms could be immunoprecipated but the identity of the isoforms cannot be unambigously established with the goat anti-Bim (N20) antibody used for immunoblotting. The authors refer to isoform (BimL O43521-2) (the most prominent coimmunoprecipitated form), isoform BimEL (O43521-1) and isoform BimS (O43521-3). The curation tentatively followed the authors statement. mif-biml-4 764357 n/a 764367 unspecified role unspecified role prey prey n/a-x-x 764361 unspecified role unspecified role bait bait physical association physical association false false false 2B Several Bim isoforms could be immunoprecipated but the identity of the isoforms cannot be unambigously established with the goat anti-Bim (N20) antibody used for immunoblotting. The authors refer to isoform (BimL O43521-2) (the most prominent coimmunoprecipitated form), isoform BimEL (O43521-1) and isoform BimS (O43521-3). The curation tentatively followed the authors statement. bcl2ll1-mif 764358 n/a 764361 unspecified role unspecified role prey prey n/a 764362 unspecified role unspecified role bait bait physical association physical association false false false mif-biml 764359 N/A 764362 unspecified role unspecified role prey prey region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. N/A 764361 unspecified role unspecified role bait bait region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) physical association physical association false false false 1B mif-biml-1 764360 N/A 764362 unspecified role unspecified role prey prey region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. N/A 764361 unspecified role unspecified role bait bait human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. physical association physical association false false false 2A Several Bim isoforms could be immunoprecipated but the identity of the isoforms cannot be established with the goat anti-Bim (N20) antibody used for immunoblotting. Isoform BimL (which was transfected) is given as the most prominent coimmunoprecipitated form. Additional bands are indicated as isoform BimEL (O43521-1) and isoform BimS (O43521-3). P14174; O43521-2 transfection