UniProt UniProt http://www.uniprot.org spensberger-2008-3 Myeloid transforming protein Evi1 interacts with methyl-CpG binding domain protein 3 and inhibits in vitro histone deacetylation by Mbd3/Mi-2/NuRD. human-phoenix Homo sapiens Phoenix cells phoenix Human Phoenix HEK 293T cells Phoenix cells are a derivative of 293 cells which have a very high efficiency of transfection (80-90%) by standard calcium phosphate methods. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Spensberger D., Vermeulen M., Le Guezennec X., Beekman R., van Hoven A., Bindels E., Stunnenberg H., Delwel R. Apoptosis - Interactions involving proteins with a function related to apoptosis h.delwel@erasmusmc.nl mouse 17 day total embryo cDNA (Clontech) Biochemistry (0006-2960) 2008 Only protein-protein interactions imex curation spensberger-2008-8 Myeloid transforming protein Evi1 interacts with methyl-CpG binding domain protein 3 and inhibits in vitro histone deacetylation by Mbd3/Mi-2/NuRD. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. tap tandem affinity purification TAP TAP tap western blot western blot Immuno blot Immuno blot Spensberger D., Vermeulen M., Le Guezennec X., Beekman R., van Hoven A., Bindels E., Stunnenberg H., Delwel R. Apoptosis - Interactions involving proteins with a function related to apoptosis 293T cells, stably expressing TAP-tagged mouse MBD3, were transiently transfected (or not) with HA-tagged EVi1 plasmid. h.delwel@erasmusmc.nl mouse 17 day total embryo cDNA (Clontech) Biochemistry (0006-2960) 2008 Only protein-protein interactions imex curation spensberger-2008-1 Myeloid transforming protein Evi1 interacts with methyl-CpG binding domain protein 3 and inhibits in vitro histone deacetylation by Mbd3/Mi-2/NuRD. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Spensberger D., Vermeulen M., Le Guezennec X., Beekman R., van Hoven A., Bindels E., Stunnenberg H., Delwel R. Apoptosis - Interactions involving proteins with a function related to apoptosis h.delwel@erasmusmc.nl mouse 17 day total embryo cDNA (Clontech) Biochemistry (0006-2960) 2008 Only protein-protein interactions imex curation spensberger-2008-2 Myeloid transforming protein Evi1 interacts with methyl-CpG binding domain protein 3 and inhibits in vitro histone deacetylation by Mbd3/Mi-2/NuRD. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Spensberger D., Vermeulen M., Le Guezennec X., Beekman R., van Hoven A., Bindels E., Stunnenberg H., Delwel R. Apoptosis - Interactions involving proteins with a function related to apoptosis h.delwel@erasmusmc.nl mouse 17 day total embryo cDNA (Clontech) Biochemistry (0006-2960) 2008 Only protein-protein interactions imex curation spensberger-2008-4 Myeloid transforming protein Evi1 interacts with methyl-CpG binding domain protein 3 and inhibits in vitro histone deacetylation by Mbd3/Mi-2/NuRD. in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Spensberger D., Vermeulen M., Le Guezennec X., Beekman R., van Hoven A., Bindels E., Stunnenberg H., Delwel R. Apoptosis - Interactions involving proteins with a function related to apoptosis h.delwel@erasmusmc.nl mouse 17 day total embryo cDNA (Clontech) Biochemistry (0006-2960) 2008 Only protein-protein interactions imex curation spensberger-2008-5 Myeloid transforming protein Evi1 interacts with methyl-CpG binding domain protein 3 and inhibits in vitro histone deacetylation by Mbd3/Mi-2/NuRD. human-phoenix Homo sapiens Phoenix cells phoenix Human Phoenix HEK 293T cells Phoenix cells are a derivative of 293 cells which have a very high efficiency of transfection (80-90%) by standard calcium phosphate methods. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Spensberger D., Vermeulen M., Le Guezennec X., Beekman R., van Hoven A., Bindels E., Stunnenberg H., Delwel R. Apoptosis - Interactions involving proteins with a function related to apoptosis h.delwel@erasmusmc.nl mouse 17 day total embryo cDNA (Clontech) Biochemistry (0006-2960) 2008 Only protein-protein interactions imex curation spensberger-2008-6 Myeloid transforming protein Evi1 interacts with methyl-CpG binding domain protein 3 and inhibits in vitro histone deacetylation by Mbd3/Mi-2/NuRD. mouse-nfs56 Mus musculus myeloid leukemia cell line NFS56 nfs56 myeloid leukemia cell lines NFS56 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Spensberger D., Vermeulen M., Le Guezennec X., Beekman R., van Hoven A., Bindels E., Stunnenberg H., Delwel R. Apoptosis - Interactions involving proteins with a function related to apoptosis h.delwel@erasmusmc.nl mouse 17 day total embryo cDNA (Clontech) Biochemistry (0006-2960) 2008 Only protein-protein interactions imex curation spensberger-2008-7 Myeloid transforming protein Evi1 interacts with methyl-CpG binding domain protein 3 and inhibits in vitro histone deacetylation by Mbd3/Mi-2/NuRD. human-phoenix Homo sapiens Phoenix cells phoenix Human Phoenix HEK 293T cells Phoenix cells are a derivative of 293 cells which have a very high efficiency of transfection (80-90%) by standard calcium phosphate methods. confocal microscopy confocal microscopy anti tag immunost anti tag immunostaining anti tag immunost Spensberger D., Vermeulen M., Le Guezennec X., Beekman R., van Hoven A., Bindels E., Stunnenberg H., Delwel R. Apoptosis - Interactions involving proteins with a function related to apoptosis h.delwel@erasmusmc.nl mouse 17 day total embryo cDNA (Clontech) Biochemistry (0006-2960) 2008 Only protein-protein interactions imex curation spensberger-2008-9 Myeloid transforming protein Evi1 interacts with methyl-CpG binding domain protein 3 and inhibits in vitro histone deacetylation by Mbd3/Mi-2/NuRD. mouse-32d Mouse 32d bone marrow cells 32d established from long-term bone marrow cultures of C3H/HeJ mice infected with the Friend murine leukemia virus; cells are constitutively growth factor-dependent molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column western blot western blot Immuno blot Immuno blot Spensberger D., Vermeulen M., Le Guezennec X., Beekman R., van Hoven A., Bindels E., Stunnenberg H., Delwel R. Apoptosis - Interactions involving proteins with a function related to apoptosis 293T cells, stably expressing TAP-tagged mouse MBD3, were transiently transfected with HA-tagged EVi1 plasmid. h.delwel@erasmusmc.nl mouse 17 day total embryo cDNA (Clontech) Biochemistry (0006-2960) 2008 Only protein-protein interactions imex curation q9z2d8-1 Methyl-CpG-binding domain protein 3 Mbd3 Methyl-CpG-binding protein MBD3 protein protein mouse Mus musculus Mouse MERKRWECPALPQGWEREEVPRRSGLSAGHRDVFYYSPSGKKFRSKPQLARYLGGSMDLSTFDFRTGKMLMNKMNKSRQRVRYDSSNQVKGKPDLNTALPVRQTASIFKQPVTKITNHPSNKVKSDPQKAVDQPRQLFWEKKLSGLSAFDIAEELVRTMDLPKGLQGVGPGCTDETLLSAIASALHTSTLPITGQLSAAVEKNPGVWLNTAQPLCKAFMVTDDDIRKQEELVQQVRKRLEEALMADMLAHVEELARDGEAPLDKACAEEEEEEEEEEEEPEPERV mecom_mouse Histone-lysine N-methyltransferase MECOM Mds1 Myelodysplasia syndrome 1 protein homolog Mecom Evi1 Ecotropic virus integration site 1 protein MDS1 and EVI1 complex locus protein Prdm3 protein protein mouse Mus musculus Mouse MRSKGRARKLATSNECAYGNYPEIPLEEMPDADADGITSVPSLHIQEPCSPATSSESFTPKEGSPYKAPIYIPDDIPIPDEFELRESTMPGAGLGIWTKRKIEIGEKFGPYMGEQRSDLKDSSYGWEILDEFCNVKFCIDASQPDVGSWLKYIRFAGCYDQHNLVACQINDQIFYRVVADIAPGEELLLFMKSEEDPHEPMAPDIHEERQHRCEDCDQLFESKAELADHQKFPCSTPHSAFSMVEEDLQQNLESESDLREIHGNQDCKECDRVFPDLQSLEKHMLSHTEEREYKCDQCPKAFNWKSNLIRHQMSHDSGKHYECENCAKVFTDPSNLQRHIRSQHVGARAHACPECGKTFATSSGLKQHKHIHSSVKPFICEVCHKSYTQFSNLCRHKRMHADCRTQIKCKDCGQMFSTTSSLNKHRRFCEGKNHFAAGGFFGQGISLPGTPAMDKTSMVNMSHANPGLADYFGTNRHPAGLTFPTAPGFSFSFPGLFPSGLYHRPPLIPASPPVKGLSSTEQSNKCQSPLLTHPQILPATQDILKALSKHPPVGDNKPVELLPERSSEERPLEKISDQSESSDLDDVSTPSGSDLETTSGSDLESDLESDKEKCKENGKMFKDKVSPLQNLASITNKKEHNNHSVFSASVEEQSAVSGAVNDSIKAIASIAEKYFGSTGLVGLQDKKVGALPYPSMFPLPFFPAFSQSMYPFPDRDLRSLPLKMEPQSPSEVKKLQKGSSESPFDLTTKRKDEKPLTSGPSKPSGTPATSQDQPLDLSMGSRGRASGTKLTEPRKNHVFGEKKGSNMDTRPSSDGSLQHARPTPFFMDPIYRVEKRKLTDPLEALKEKYLRPSPGFLFHPQMSAIENMAEKLESFSALKPEASELLQSVPSMFSFRAPPNTLPENLLRKGKERYTCRYCGKIFPRSANLTRHLRTHTGEQPYRCKYCDRSFSISSNLQRHVRNIHNKEKPFKCHLCDRCFGQQTNLDRHLKKHENGNMSGTATSSPHSELESAGAILDDKEDAYFTEIRNFIGNSNHGSQSPRNMEERMNGSHFKDKKALATSQNSDLLDDEEVEDEVLLDEEDEDNDIPGKPRKELGVTRLDEEIPEDDYEEAGALEMSCKASPVRYKEEDYKSGLSALDHIRHFTDSLKMREMEENQYTDAELSSISSSHVPEELKQTLHRKSKSQAYAMMLSLSDKDSLHPTSHSSSNVWHSMARAAAESSAIQSISHV mbd3_mouse Methyl-CpG-binding domain protein 3 Mbd3 Methyl-CpG-binding protein MBD3 protein protein mouse Mus musculus Mouse MERKRWECPALPQGWEREEVPRRSGLSAGHRDVFYYSPSGKKFRSKPQLARYLGGSMDLSTFDFRTGKMLMNKMNKSRQRVRYDSSNQVKGKPDLNTALPVRQTASIFKQPVTKITNHPSNKVKSDPQKAVDQPRQLFWEKKLSGLSAFDIAEELVRTMDLPKGLQGVGPGCTDETLLSAIASALHTSTLPITGQLSAAVEKNPGVWLNTAQPLCKAFMVTDDDIRKQEELVQQVRKRLEEALMADMLAHVEELARDGEAPLDKACAEEEEEEEEEEEEPEPERV rbbp7_human Histone-binding protein RBBP7 RBBP7 RBAP46 Retinoblastoma-binding protein 7 Retinoblastoma-binding protein p46 Histone acetyltransferase type B subunit 2 Nucleosome-remodeling factor subunit RBAP46 protein protein human Homo sapiens Human MASKEMFEDTVEERVINEEYKIWKKNTPFLYDLVMTHALQWPSLTVQWLPEVTKPEGKDYALHWLVLGTHTSDEQNHLVVARVHIPNDDAQFDASHCDSDKGEFGGFGSVTGKIECEIKINHEGEVNRARYMPQNPHIIATKTPSSDVLVFDYTKHPAKPDPSGECNPDLRLRGHQKEGYGLSWNSNLSGHLLSASDDHTVCLWDINAGPKEGKIVDAKAIFTGHSAVVEDVAWHLLHESLFGSVADDQKLMIWDTRSNTTSKPSHLVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHTFESHKDEIFQVHWSPHNETILASSGTDRRLNVWDLSKIGEEQSAEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQIWQMAENIYNDEESDVTTSELEGQGS mta2_human Metastasis-associated protein MTA2 MTA2 MTA1L1 PID Metastasis-associated 1-like 1 p53 target protein in deacetylase complex protein protein human Homo sapiens Human MAANMYRVGDYVYFENSSSNPYLVRRIEELNKTANGNVEAKVVCLFRRRDISSSLNSLADSNAREFEEESKQPGVSEQQRHQLKHRELFLSRQFESLPATHIRGKCSVTLLNETDILSQYLEKEDCFFYSLVFDPVQKTLLADQGEIRVGCKYQAEIPDRLVEGESDNRNQQKMEMKVWDPDNPLTDRQIDQFLVVARAVGTFARALDCSSSIRQPSLHMSAAAASRDITLFHAMDTLQRNGYDLAKAMSTLVPQGGPVLCRDEMEEWSASEAMLFEEALEKYGKDFNDIRQDFLPWKSLASIVQFYYMWKTTDRYIQQKRLKAAEADSKLKQVYIPTYTKPNPNQIISVGSKPGMNGAGFQKGLTCESCHTTQSAQWYAWGPPNMQCRLCASCWIYWKKYGGLKTPTQLEGATRGTTEPHSRGHLSRPEAQSLSPYTTSANRAKLLAKNRQTFLLQTTKLTRLARRMCRDLLQPRRAARRPYAPINANAIKAECSIRLPKAAKTPLKIHPLVRLPLATIVKDLVAQAPLKPKTPRGTKTPINRNQLSQNRGLGGIMVKRAYETMAGAGVPFSANGRPLASGIRSSSQPAAKRQKLNPADAPNPVVFVATKDTRALRKALTHLEMRRAARRPNLPLKVKPTLIAVRPPVPLPAPSHPASTNEPIVLED hdac2_human Histone deacetylase 2 HDAC2 protein protein human Homo sapiens Human MAYSQGGGKKKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKATAEEMTKYHSDEYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVAGAVKLNRQQTDMAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNFPMRDGIDDESYGQIFKPIISKVMEMYQPSAVVLQCGADSLSGDRLGCFNLTVKGHAKCVEVVKTFNLPLLMLGGGGYTIRNVARCWTYETAVALDCEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTPEYMEKIKQRLFENLRMLPHAPGVQMQAIPEDAVHEDSGDEDGEDPDKRISIRASDKRIACDEEFSDSEDEGEGGRRNVADHKKGAKKARIEEDKKETEDKKTDVKEEDKSKDNSGEKTDTKGTKSEQLSNP mbd3_human Methyl-CpG-binding domain protein 3 MBD3 Methyl-CpG-binding protein MBD3 protein protein human Homo sapiens Human MERKRWECPALPQGWEREEVPRRSGLSAGHRDVFYYSPSGKKFRSKPQLARYLGGSMDLSTFDFRTGKMLMSKMNKSRQRVRYDSSNQVKGKPDLNTALPVRQTASIFKQPVTKITNHPSNKVKSDPQKAVDQPRQLFWEKKLSGLNAFDIAEELVKTMDLPKGLQGVGPGCTDETLLSAIASALHTSTMPITGQLSAAVEKNPGVWLNTTQPLCKAFMVTDEDIRKQEELVQQVRKRLEEALMADMLAHVEELARDGEAPLDKACAEDDDEEDEEEEEEEPDPDPEMEHV mbd3-evi1 767908 n/a 767917 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-phoenix Homo sapiens Phoenix cells phoenix Human Phoenix HEK 293T cells Phoenix cells are a derivative of 293 cells which have a very high efficiency of transfection (80-90%) by standard calcium phosphate methods. n/a 767918 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false [EBI-1994660] The range 191-429 was N-terminal and is not anymore. human-phoenix Homo sapiens Phoenix cells phoenix Human Phoenix HEK 293T cells Phoenix cells are a derivative of 293 cells which have a very high efficiency of transfection (80-90%) by standard calcium phosphate methods. association association false false false 2A and C and 3B evi1-mbd3-2 767908 n/a 767918 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-phoenix Homo sapiens Phoenix cells phoenix Human Phoenix HEK 293T cells Phoenix cells are a derivative of 293 cells which have a very high efficiency of transfection (80-90%) by standard calcium phosphate methods. n/a 767917 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-phoenix Homo sapiens Phoenix cells phoenix Human Phoenix HEK 293T cells Phoenix cells are a derivative of 293 cells which have a very high efficiency of transfection (80-90%) by standard calcium phosphate methods. association association false false false 2A Q9Z2D8-1, P14404 transfection mbd3-evi1-3 767909 n/a 767918 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. n/a 767919 unspecified role unspecified role bait bait region tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. n/a 767920 unspecified role unspecified role prey prey n/a 767921 unspecified role unspecified role prey prey n/a 767922 unspecified role unspecified role prey prey association association false false false 5C P14404 (HA-Evi1) transfection mbd3-mta2-1 767909 n/a 767919 unspecified role unspecified role bait bait region tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. n/a 767921 unspecified role unspecified role prey prey n/a 767922 unspecified role unspecified role prey prey n/a 767920 unspecified role unspecified role prey prey association association false false false 5C HA-Evi1 was not transfected. evi1-mbd3 767910 n/a 767918 unspecified role unspecified role bait bait n/a 767917 unspecified role unspecified role prey prey physical association physical association false false false 1A evi1-mbd3-1 767911 n/a 767917 unspecified role unspecified role prey prey region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false n/a 767918 unspecified role unspecified role bait bait physical association physical association false false false 1B and 1D mbd3-evi1-1 767912 n/a 767918 unspecified role unspecified role prey prey region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false [EBI-1994697] The range 191-315 was N-terminal and is not anymore. region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-phoenix Homo sapiens Phoenix cells phoenix Human Phoenix HEK 293T cells Phoenix cells are a derivative of 293 cells which have a very high efficiency of transfection (80-90%) by standard calcium phosphate methods. n/a 767917 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) association association false false false 3C evi1-mbd3-3 767913 n/a 767918 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-phoenix Homo sapiens Phoenix cells phoenix Human Phoenix HEK 293T cells Phoenix cells are a derivative of 293 cells which have a very high efficiency of transfection (80-90%) by standard calcium phosphate methods. n/a 767923 unspecified role unspecified role prey prey association association false false false 3D evi1-mbd3-4 767914 n/a 767918 unspecified role unspecified role bait bait n/a 767919 unspecified role unspecified role prey prey association association false false false 3E evi1-mbd3-5 767915 n/a 767918 unspecified role unspecified role neutral component neutral component region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 767919 unspecified role unspecified role neutral component neutral component region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false 5A mbd3-evi1-2 767916 n/a 767918 unspecified role unspecified role neutral component neutral component region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 767919 unspecified role unspecified role neutral component neutral component association association false false false 5B Appear to form high molecular weight complexes ~1.5mDa