IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ wiedemeyer-2008-1 Feedback circuit among INK4 tumor suppressors constrains human glioblastoma development. human-astrocyte Homo sapiens astrocyte astrocyte Astrocytes [Brain astrocytes; Astroglia] ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Wiedemeyer R., Brennan C., Heffernan TP., Xiao Y., Mahoney J., Protopopov A., Zheng H., Bignell G., Furnari F., Cavenee WK., Hahn WC., Ichimura K., Collins VP., Chu GC., Stratton MR., Ligon KL., Futreal PA., Chin L. Apoptosis - Interactions involving proteins with a function related to apoptosis cbrennan@mskcc.org,lynda_chin@dfci.harvard.edu Cancer Cell (1535-6108) 2008 Only protein-protein interactions 1 imex curation Cancer - Interactions investigated in the context of cancer wiedemeyer-2008-2 Feedback circuit among INK4 tumor suppressors constrains human glioblastoma development. human-ln_229 Homo sapiens malignant glioma cell line LN-229 ln_229 Human malignant glioma cell line LN-229 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Wiedemeyer R., Brennan C., Heffernan TP., Xiao Y., Mahoney J., Protopopov A., Zheng H., Bignell G., Furnari F., Cavenee WK., Hahn WC., Ichimura K., Collins VP., Chu GC., Stratton MR., Ligon KL., Futreal PA., Chin L. Apoptosis - Interactions involving proteins with a function related to apoptosis The source of CDKN2C was taken from PMID 9528803. (The donor of the construct is an author of this paper). cbrennan@mskcc.org,lynda_chin@dfci.harvard.edu Cancer Cell (1535-6108) 2008 Only protein-protein interactions 1 imex curation Cancer - Interactions investigated in the context of cancer cdn2c_human_gene Human CDKN2C (p18-INK4C) gene gene human Homo sapiens Human e2f1_human Transcription factor E2F1 Retinoblastoma-associated protein 1 Retinoblastoma-binding protein 3 PBR3 E2F1 RBBP3 pRB-binding protein E2F-1 protein protein human Homo sapiens Human MALAGAPAGGPCAPALEALLGAGALRLLDSSQIVIISAAQDASAPPAPTGPAAPAAGPCDPDLLLFATPQAPRPTPSAPRPALGRPPVKRRLDLETDHQYLAESSGPARGRGRHPGKGVKSPGEKSRYETSLNLTTKRFLELLSHSADGVVDLNWAAEVLKVQKRRIYDITNVLEGIQLIAKKSKNHIQWLGSHTTVGVGGRLEGLTQDLRQLQESEQQLDHLMNICTTQLRLLSEDTDSQRLAYVTCQDLRSIADPAEQMVMVIKAPPETQLQAVDSSENFQISLKSKQGPIDVFLCPEETVGGISPGKTPSQEVTSEEENRATDSATIVSPPPSSPPSSLTTDPSQSLLSLEQEPLLSRMGSLRAPVDEDRLSPLVAADSLLEHVREDFSGLLPEEFISLSPPHEALDYHFGLEEGEGIRDLFDCDFGDLTPLDF cdn2c_human Cyclin-dependent kinase 4 inhibitor C CDKN2C CDKN6 p18-INK4c Cyclin-dependent kinase 6 inhibitor p18-INK6 protein protein human Homo sapiens Human MAEPWGNELASAAARGDLEQLTSLLQNNVNVNAQNGFGRTALQVMKLGNPEIARRLLLRGANPDLKDRTGFAVIHDAARAGFLDTLQTLLEFQADVNIEDNEGNLPLHLAAKEGHLRVVEFLVKHTASNVGHRNHKGDTACDLARLYGRNEVVSLMQANGAGGATNLQ cdk6_human Cyclin-dependent kinase 6 CDK6 Serine/threonine-protein kinase PLSTIRE Cell division protein kinase 6 CDKN6 protein protein human Homo sapiens Human MEKDGLCRADQQYECVAEIGEGAYGKVFKARDLKNGGRFVALKRVRVQTGEEGMPLSTIREVAVLRHLETFEHPNVVRLFDVCTVSRTDRETKLTLVFEHVDQDLTTYLDKVPEPGVPTETIKDMMFQLLRGLDFLHSHRVVHRDLKPQNILVTSSGQIKLADFGLARIYSFQMALTSVVVTLWYRAPEVLLQSSYATPVDLWSVGCIFAEMFRRKPLFRGSSDVDQLGKILDVIGLPGEEDWPRDVALPRQAFHSKSAQPIEKFVTDIDELGKDLLLKCLTFNPAKRISAYSALSHPYFQDLERCKENLDSHLPPSQNTSELNTA e2f1-cdkn2c E2F1 binds to the CDK2NB (p18-INK4C) promoter in a ChIP assay in human astrocytes 733187 N/A 733189 unspecified role unspecified role prey prey N/A 733190 unspecified role unspecified role bait bait association association false false false 2 A cdk-cdkn2c CDK6 coimmunoprecipitates CDKN2C (p18-INK4C) in LN-229 lysates 733188 N/A 733191 unspecified role unspecified role prey prey P42773:p.Phe37Ile mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false P42773:p.Ala61Asp mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false N/A 733192 unspecified role unspecified role bait bait physical association physical association false false false 3 D P42773 infection This interaction is curated with the only form of CDKN2C (p18-INK4C) available in the UniProtKB entry.