IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ gao-2008-1 A protein-protein interaction network of transcription factors acting during liver cell proliferation. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Gao J., Li WX., Feng SQ., Yuan YS., Wan DF., Han W., Yu Y. Apoptosis - Interactions involving proteins with a function related to apoptosis Interactions ranked by authors into four levels: GRADE I, II, III and IV. IV is the strongest Directed yeast two-hybrid assays were used to investigate the interactions between a group of transcription factors previously identified as involved in regulaton of liver cell growth and in liver cancer development. yanyu@sjtu.edu.cn Genomics (0888-7543) 2008 Only protein-protein interactions imex curation Cancer - Interactions investigated in the context of cancer gao-2008-2 A protein-protein interaction network of transcription factors acting during liver cell proliferation. in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Gao J., Li WX., Feng SQ., Yuan YS., Wan DF., Han W., Yu Y. Apoptosis - Interactions involving proteins with a function related to apoptosis Interactions ranked by authors into four levels: GRADE I, II, III and IV. IV is the strongest Directed yeast two-hybrid assays were used to investigate the interactions between a group of transcription factors previously identified as involved in regulaton of liver cell growth and in liver cancer development. yanyu@sjtu.edu.cn Genomics (0888-7543) 2008 Only protein-protein interactions imex curation Cancer - Interactions investigated in the context of cancer gao-2008-3 A protein-protein interaction network of transcription factors acting during liver cell proliferation. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Gao J., Li WX., Feng SQ., Yuan YS., Wan DF., Han W., Yu Y. Apoptosis - Interactions involving proteins with a function related to apoptosis Interactions ranked by authors into four levels: GRADE I, II, III and IV. IV is the strongest Directed yeast two-hybrid assays were used to investigate the interactions between a group of transcription factors previously identified as involved in regulaton of liver cell growth and in liver cancer development. yanyu@sjtu.edu.cn Genomics (0888-7543) 2008 Only protein-protein interactions imex curation Cancer - Interactions investigated in the context of cancer atf3_human Cyclic AMP-dependent transcription factor ATF-3 Activating transcription factor 3 ATF3 protein protein human Homo sapiens Human MMLQHPGQVSASEVSASAIVPCLSPPGSLVFEDFANLTPFVKEELRFAIQNKHLCHRMSSALESVTVSDRPLGVSITKAEVAPEEDERKKRRRERNKIAAAKCRNKKKEKTECLQKESEKLESVNAELKAQIEELKNEKQHLIYMLNLHRPTCIVRAQNGRTPEDERNLFIQQIKEGTLQS fhl2_human Four and a half LIM domains protein 2 Skeletal muscle LIM-protein 3 LIM domain protein DRAL FHL2 DRAL SLIM3 protein protein human Homo sapiens Human MTERFDCHHCNESLFGKKYILREESPYCVVCFETLFANTCEECGKPIGCDCKDLSYKDRHWHEACFHCSQCRNSLVDKPFAAKEDQLLCTDCYSNEYSSKCQECKKTIMPGTRKMEYKGSSWHETCFICHRCQQPIGTKSFIPKDNQNFCVPCYEKQHAMQCVQCKKPITTGGVTYREQPWHKECFVCTACRKQLSGQRFTARDDFAYCLNCFCDLYAKKCAGCTNPISGLGGTKYISFEERQWHNDCFNCKKCSLSLVGRGFLTERDDILCPDCGKDI id3_human DNA-binding protein inhibitor ID-3 ID3 1R21 BHLHB25 Inhibitor of DNA binding 3 ID-like protein inhibitor HLH 1R21 Helix-loop-helix protein HEIR-1 HEIR1 Class B basic helix-loop-helix protein 25 Inhibitor of differentiation 3 protein protein human Homo sapiens Human MKALSPVRGCYEAVCCLSERSLAIARGRGKGPAAEEPLSLLDDMNHCYSRLRELVPGVPRGTQLSQVEILQRVIDYILDLQVVLAEPAPGPPDGPHLPIQTAELTPELVISNDKRSFCH atf4_human Cyclic AMP-dependent transcription factor ATF-4 Activating transcription factor 4 CREB2 ATF4 TXREB Cyclic AMP-responsive element-binding protein 2 Tax-responsive enhancer element-binding protein 67 protein protein human Homo sapiens Human MTEMSFLSSEVLVGDLMSPFDQSGLGAEESLGLLDDYLEVAKHFKPHGFSSDKAKAGSSEWLAVDGLVSPSNNSKEDAFSGTDWMLEKMDLKEFDLDALLGIDDLETMPDDLLTTLDDTCDLFAPLVQETNKQPPQTVNPIGHLPESLTKPDQVAPFTFLQPLPLSPGVLSSTPDHSFSLELGSEVDITEGDRKPDYTAYVAMIPQCIKEEDTPSDNDSGICMSPESYLGSPQHSPSTRGSPNRSLPSPGVLCGSARPKPYDPPGEKMVAAKVKGEKLDKKLKKMEQNKTAATRYRQKKRAEQEALTGECKELEKKNEALKERADSLAKEIQYLKDLIEEVRKARGKKRVP 3BBB7379DC3B0D07 No Uniprot Update and Caution removed " The protein could not be merged with EBI-12907955 because of some conflicts with the protein sequence (features which cannot be shifted)." -EBI-12907955 no longer exists. zn212_human Zinc finger protein 212 ZNF212 ZNFC150 Zinc finger protein C2H2-150 protein protein human Homo sapiens Human MAESAPARHRRKRRSTPLTSSTLPSQATEKSSYFQTTEISLWTVVAAIQAVEKKMESQAARLQSLEGRTGTAEKKLADCEKMAVEFGNQLEGKWAVLGTLLQEYGLLQRRLENVENLLRNRNFWILRLPPGSKGEAPKVSRSLENDGVCFTEQEWENLEDWQKELYRNVMESNYETLVSLKVLGQTEGEAELGTEMLGDLEEEGPGGAHPAGGVMIKQELQYTQEGPADLPGEFSCIAEEQAFLSPEQTELWGGQGSSVLLETGPGDSTLEEPVGSRVPSSSRTVGCPKQKSHRQVQLDQECGQGLKLKKDTSRPYECSECEITFRYKQQLATHLRSHSGWGSCTPEEPEESLRPRPRLKPQTKKAKLHQCDVCLRSFSCKVSLVTHQRCHLQEGPSAGQHVQERFSPNSLVALPGHIPWRKSRSSLICGYCGKSFSHPSDLVRHQRIHTGERPYSCTECEKSFVQKQHLLQHQKIHQRERGGLALEPGRPNGLL cnot3_human CCR4-NOT transcription complex subunit 3 CCR4-associated factor 3 Leukocyte receptor cluster member 2 CNOT3 KIAA0691 NOT3 LENG2 protein protein human Homo sapiens Human MADKRKLQGEIDRCLKKVSEGVEQFEDIWQKLHNAANANQKEKYEADLKKEIKKLQRLRDQIKTWVASNEIKDKRQLIDNRKLIETQMERFKVVERETKTKAYSKEGLGLAQKVDPAQKEKEEVGQWLTNTIDTLNMQVDQFESEVESLSVQTRKKKGDKDKQDRIEGLKRHIEKHRYHVRMLETILRMLDNDSILVDAIRKIKDDVEYYVDSSQDPDFEENEFLYDDLDLEDIPQALVATSPPSHSHMEDEIFNQSSSTPTSTTSSSPIPPSPANCTTENSEDDKKRGRSTDSEVSQSPAKNGSKPVHSNQHPQSPAVPPTYPSGPPPAASALSTTPGNNGVPAPAAPPSALGPKASPAPSHNSGTPAPYAQAVAPPAPSGPSTTQPRPPSVQPSGGGGGGSGGGGSSSSSNSSAGGGAGKQNGATSYSSVVADSPAEVALSSSGGNNASSQALGPPSGPHNPPPSTSKEPSAAAPTGAGGVAPGSGNNSGGPSLLVPLPVNPPSSPTPSFSDAKAAGALLNGPPQFSTAPEIKAPEPLSSLKSMAERAAISSGIEDPVPTLHLTERDIILSSTSAPPASAQPPLQLSEVNIPLSLGVCPLGPVPLTKEQLYQQAMEEAAWHHMPHPSDSERIRQYLPRNPCPTPPYHHQMPPPHSDTVEFYQRLSTETLFFIFYYLEGTKAQYLAAKALKKQSWRFHTKYMMWFQRHEEPKTITDEFEQGTYIYFDYEKWGQRKKEGFTFEYRYLEDRDLQ csk_human Tyrosine-protein kinase CSK CSK C-Src kinase Protein-tyrosine kinase CYL protein protein human Homo sapiens Human MSAIQAAWPSGTECIAKYNFHGTAEQDLPFCKGDVLTIVAVTKDPNWYKAKNKVGREGIIPANYVQKREGVKAGTKLSLMPWFHGKITREQAERLLYPPETGLFLVRESTNYPGDYTLCVSCDGKVEHYRIMYHASKLSIDEEVYFENLMQLVEHYTSDADGLCTRLIKPKVMEGTVAAQDEFYRSGWALNMKELKLLQTIGKGEFGDVMLGDYRGNKVAVKCIKNDATAQAFLAEASVMTQLRHSNLVQLLGVIVEEKGGLYIVTEYMAKGSLVDYLRSRGRSVLGGDCLLKFSLDVCEAMEYLEGNNFVHRDLAARNVLVSEDNVAKVSDFGLTKEASSTQDTGKLPVKWTAPEALREKKFSTKSDVWSFGILLWEIYSFGRVPYPRIPLKDVVPRVEKGYKMDAPDGCPPAVYEVMKNCWHLDAAMRPSFLQLREQLEHIKTHELHL requ_human Zinc finger protein ubi-d4 DPF2 REQ UBID4 Protein requiem Apoptosis response zinc finger protein D4, zinc and double PHD fingers family 2 BAF45D BRG1-associated factor 45D protein protein human Homo sapiens Human MAAVVENVVKLLGEQYYKDAMEQCHNYNARLCAERSVRLPFLDSQTGVAQSNCYIWMEKRHRGPGLASGQLYSYPARRWRKKRRAHPPEDPRLSFPSIKPDTDQTLKKEGLISQDGSSLEALLRTDPLEKRGAPDPRVDDDSLGEFPVTNSRARKRILEPDDFLDDLDDEDYEEDTPKRRGKGKSKGKGVGSARKKLDASILEDRDKPYACDICGKRYKNRPGLSYHYAHSHLAEEEGEDKEDSQPPTPVSQRSEEQKSKKGPDGLALPNNYCDFCLGDSKINKKTGQPEELVSCSDCGRSGHPSCLQFTPVMMAAVKTYRWQCIECKCCNICGTSENDDQLLFCDDCDRGYHMYCLTPSMSEPPEGSWSCHLCLDLLKEKASIYQNQNSS s30bp_human SAP30-binding protein Transcriptional regulator protein HCNGP SAP30BP HTRG HCNGP HTRP protein protein human Homo sapiens Human MAGKKNVLSSLAVYAEDSEPESDGEAGIEAVGSAAEEKGGLVSDAYGEDDFSRLGGDEDGYEEEEDENSRQSEDDDSETEKPEADDPKDNTEAEKRDPQELVASFSERVRNMSPDEIKIPPEPPGRCSNHLQDKIQKLYERKIKEGMDMNYIIQRKKEFRNPSIYEKLIQFCAIDELGTNYPKDMFDPHGWSEDSYYEALAKAQKIEMDKLEKAKKERTKIEFVTGTKKGTTTNATSTTTTTASTAVADAQKRKSKWDSAIPVTTIAQPTILTTTATLPAVVTVTTSASGSKTTVISAVGTIVKKAKQ puf60_human Poly(U)-binding-splicing factor PUF60 60 kDa poly(U)-binding-splicing factor FUSE-binding protein-interacting repressor Siah-binding protein 1 Ro-binding protein 1 PUF60 SIAHBP1 FIR ROBPI protein protein human Homo sapiens Human MATATIALQVNGQQGGGSEPAAAAAVVAAGDKWKPPQGTDSIKMENGQSTAAKLGLPPLTPEQQEALQKAKKYAMEQSIKSVLVKQTIAHQQQQLTNLQMAAVTMGFGDPLSPLQSMAAQRQRALAIMCRVYVGSIYYELGEDTIRQAFAPFGPIKSIDMSWDSVTMKHKGFAFVEYEVPEAAQLALEQMNSVMLGGRNIKVGRPSNIGQAQPIIDQLAEEARAFNRIYVASVHQDLSDDDIKSVFEAFGKIKSCTLARDPTTGKHKGYGFIEYEKAQSSQDAVSSMNLFDLGGQYLRVGKAVTPPMPLLTPATPGGLPPAAAVAAAAATAKITAQEAVAGAAVLGTLGTPGLVSPALTLAQPLGTLPQAVMAAQAPGVITGVTPARPPIPVTIPSVGVVNPILASPPTLGLLEPKKEKEEEELFPESERPEMLSEQEHMSISGSSARHMVMQKLLRKQESTVMVLRNMVDPKDIDDDLEGEVTEECGKFGAVNRVIIYQEKQGEEEDAEIIVKIFVEFSIASETHKAIQALNGRWFAGRKVVAEVYDQERFDNSDLSA stat3_human Signal transducer and activator of transcription 3 Acute-phase response factor STAT3 APRF protein protein human Homo sapiens Human MAQWNQLQQLDTRYLEQLHQLYSDSFPMELRQFLAPWIESQDWAYAASKESHATLVFHNLLGEIDQQYSRFLQESNVLYQHNLRRIKQFLQSRYLEKPMEIARIVARCLWEESRLLQTAATAAQQGGQANHPTAAVVTEKQQMLEQHLQDVRKRVQDLEQKMKVVENLQDDFDFNYKTLKSQGDMQDLNGNNQSVTRQKMQQLEQMLTALDQMRRSIVSELAGLLSAMEYVQKTLTDEELADWKRRQQIACIGGPPNICLDRLENWITSLAESQLQTRQQIKKLEELQQKVSYKGDPIVQHRPMLEERIVELFRNLMKSAFVVERQPCMPMHPDRPLVIKTGVQFTTKVRLLVKFPELNYQLKIKVCIDKDSGDVAALRGSRKFNILGTNTKVMNMEESNNGSLSAEFKHLTLREQRCGNGGRANCDASLIVTEELHLITFETEVYHQGLKIDLETHSLPVVVISNICQMPNAWASILWYNMLTNNPKNVNFFTKPPIGTWDQVAEVLSWQFSSTTKRGLSIEQLTTLAEKLLGPGVNYSGCQITWAKFCKENMAGKGFSFWVWLDNIIDLVKKYILALWNEGYIMGFISKERERAILSTKPPGTFLLRFSESSKEGGVTFTWVEKDISGKTQIQSVEPYTKQQLNNMSFAEIIMGYKIMDATNILVSPLVYLYPDIPKEEAFGKYCRPESQEHPEADPGSAAPYLKTKFICVTPTTCSNTIDLPMSPRTLDSLMQFGNNGEGAEPSAGGQFESLTFDMELTSECATSPM 6C00632211C8012D zn331_human Zinc finger protein 331 ZNF331 RITA ZNF463 ZNF361 Zinc finger protein 361 Zinc finger protein 463 C2H2-like zinc finger protein rearranged in thyroid adenomas protein protein human Homo sapiens Human MAQGLVTFADVAIDFSQEEWACLNSAQRDLYWDVMLENYSNLVSLDLESAYENKSLPTEKNIHEIRASKRNSDRRSKSLGRNWICEGTLERPQRSRGRYVNQMIINYVKRPATREGTPPRTHQRHHKENSFECKDCGKAFSRGYQLSQHQKIHTGEKPYECKECKKAFRWGNQLTQHQKIHTGEKPYECKDCGKAFRWGSSLVIHKRIHTGEKPYECKDCGKAFRRGDELTQHQRFHTGEKDYECKDCGKTFSRVYKLIQHKRIHSGEKPYECKDCGKAFICGSSLIQHKRIHTGEKPYECQECGKAFTRVNYLTQHQKIHTGEKPHECKECGKAFRWGSSLVKHERIHTGEKPYKCTECGKAFNCGYHLTQHERIHTGETPYKCKECGKAFIYGSSLVKHERIHTGVKPYGCTECGKSFSHGHQLTQHQKTHSGAKSYECKECGKACNHLNHLREHQRIHNS zn408_human Zinc finger protein 408 ZNF408 PFM14 PRDM17 PR domain zinc finger protein 17 protein protein human Homo sapiens Human MEEAEELLLEGKKALQLAREPRLGLDLGWNPSGEGCTQGLKDVPPEPTRDILALKSLPRGLALGPSLAKEQRLGVWCVGDPLQPGLLWGPLEEESASKEKGEGVKPRQEENLSLGPWGDVCACEQSSGWTSLVQRGRLESEGNVAPVRISERLHLQVYQLVLPGSELLLWPQPSSEGPSLTQPGLDKEAAVAVVTEVESAVQQEVASPGEDAAEPCIDPGSQSPSGIQAENMVSPGLKFPTQDRISKDSQPLGPLLQDGDVDEECPAQAQMPPELQSNSATQQDPDGSGASFSSSARGTQPHGYLAKKLHSPSDQCPPRAKTPEPGAQQSGFPTLSRSPPGPAGSSPKQGRRYRCGECGKAFLQLCHLKKHAFVHTGHKPFLCTECGKSYSSEESFKAHMLGHRGVRPFPCPQCDKAYGTQRDLKEHQVVHSGARPFACDQCGKAFARRPSLRLHRKTHQVPAAPAPCPCPVCGRPLANQGSLRNHMRLHTGEKPFLCPHCGRAFRQRGNLRGHLRLHTGERPYRCPHCADAFPQLPELRRHLISHTGEAHLCPVCGKALRDPHTLRAHERLHSGERPFPCPQCGRAYTLATKLRRHLKSHLEDKPYRCPTCGMGYTLPQSLRRHQLSHRPEAPCSPPSVPSAASEPTVVLLQAEPQLLDTHREEEVSPARDVVEVTISESQEKCFVVPEEPDAAPSLVLIHKDMGLGAWAEVVEVEMGT zn626_human Zinc finger protein 626 ZNF626 protein protein human Homo sapiens Human MGPLQFRDVAIEFSLEEWHCLDTAQRNLYRNVMLENYSNLVFLGITVSKPDLITCLEQGRKPLTMKRNEMIAKPSVMCSHFAQDLWPEQSMKDSFQKVVLRRYEKCEHDNLQLKKGCISVDECKVHKEGYNELNQCLTTTPRKICQCDKYVKVLHQFPNSNGQKRGHTGKKPFKYIECGKAFKQFSTLTTHKKIHTGGKPYKCEECGKAFNHSCSLTRHKKIHTGEKPYKCEECGKAFKHSSTLTTHKRNHTGEKPYKCDKCGKAFMSSSTLSKHEIIHTEKKPYKCEECGKAFNRSSTLTTHKIIHTGEKPYKCEECDKAFKYSYTLTTHKRIHTEDKPYKCEECGKAFKYSSTLTTHKRIHTGEKPYKCEECGKAFKRSSDLTTHKIIHTGEKPYKCEECGKAFKYSSNLTTHKKIHTGERPYKCEECGKAFNQSSILTTHRRIHTGEKFYKCEECGKAFKCSSNLTTHKKIHTGERPYKCEECGKAFNQSSILTTHERIILERNSTNVKNVAKPSSGPHTLLHIR ikzf4_human Zinc finger protein Eos IKZF4 KIAA1782 ZNFN1A4 Ikaros family zinc finger protein 4 protein protein human Homo sapiens Human MHTPPALPRRFQGGGRVRTPGSHRQGKDNLERDPSGGCVPDFLPQAQDSNHFIMESLFCESSGDSSLEKEFLGAPVGPSVSTPNSQHSSPSRSLSANSIKVEMYSDEESSRLLGPDERLLEKDDSVIVEDSLSEPLGYCDGSGPEPHSPGGIRLPNGKLKCDVCGMVCIGPNVLMVHKRSHTGERPFHCNQCGASFTQKGNLLRHIKLHSGEKPFKCPFCNYACRRRDALTGHLRTHSVSSPTVGKPYKCNYCGRSYKQQSTLEEHKERCHNYLQSLSTEAQALAGQPGDEIRDLEMVPDSMLHSSSERPTFIDRLANSLTKRKRSTPQKFVGEKQMRFSLSDLPYDVNSGGYEKDVELVAHHSLEPGFGSSLAFVGAEHLRPLRLPPTNCISELTPVISSVYTQMQPLPGRLELPGSREAGEGPEDLADGGPLLYRPRGPLTDPGASPSNGCQDSTDTESNHEDRVAGVVSLPQGPPPQPPPTIVVGRHSPAYAKEDPKPQEGLLRGTPGPSKEVLRVVGESGEPVKAFKCEHCRILFLDHVMFTIHMGCHGFRDPFECNICGYHSQDRYEFSSHIVRGEHKVG q6fhm2_human GNB2 hCG_20449 protein protein human Homo sapiens Human MSELEQLRQEAEQLRNQIRDARKACGDSTLTQITAGLDPVGRIQMRTRRTLRGHLAKIYAMHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPSGNFVACGGLDNICSIYSLKTREGNVRVSRELPGHTGYLSCCRFLDDNQIITSSGDTTCALWDIETGQQTVGFAGHSGDVMSLSLAPDGRTFVSGACDASIKLWDVRDSMCRQTFIGHESDINAVAFFPNGYAFTTGSDDATCRLFDLRADQELLMYSHDNIICGITSVAFSRSGRLLLAGYDDFNCNIWDAMKGDRAGVLAGHDNRVSCLGVTDDGMAVATGSWDSFLKIWN gnl1_human Guanine nucleotide-binding protein-like 1 GNL1 HSR1 GTP-binding protein HSR1 protein protein human Homo sapiens Human MPRKKPFSVKQKKKQLQDKRERKRGLQDGLRSSSNSRSGSRERREEQTDTSDGESVTHHIRRLNQQPSQGLGPRGYDPNRYRLHFERDSREEVERRKRAAREQVLQPVSAELLELDIREVYQPGSVLDFPRRPPWSYEMSKEQLMSQEERSFQDYLGKIHGAYSSEKLSYFEHNLETWRQLWRVLEMSDIVLLITDIRHPVVNFPPALYEYVTGELGLALVLVLNKVDLAPPALVVAWKHYFHQHYPQLHVVLFTSFPRDPRTPQDPSSVLKKSRRRGRGWTRALGPEQLLRACEAITVGKVDLSSWREKIARDVAGATWGNGSGEEEEEEDGPAVLVEQQTDSAMEPTGPTQERYKDGVVTIGCVGFPNVGKSSLINGLVGRKVVSVSRTPGHTRYFQTYFLTPSVKLCDCPGLIFPSLLPRQLQVLAGIYPIAQIQEPYTAVGYLASRIPVQALLHLRHPEAEDPSAEHPWCAWDICEAWAEKRGYKTAKAARNDVYRAANSLLRLAVDGRLSLCFHPPGYSEQKGTWESHPETTELVVLQGRVGPAGDEEEEEEEELSSSCEEEGEEDRDADEEGEGDEETPTSAPGSSLAGRNPYALLGEDEC gdia_human Rab GDP dissociation inhibitor alpha GDI1 OPHN2 RABGDIA XAP4 Guanosine diphosphate dissociation inhibitor 1 Oligophrenin-2 Protein XAP-4 GDIL protein protein human Homo sapiens Human MDEEYDVIVLGTGLTECILSGIMSVNGKKVLHMDRNPYYGGESSSITPLEELYKRFQLLEGPPESMGRGRDWNVDLIPKFLMANGQLVKMLLYTEVTRYLDFKVVEGSFVYKGGKIYKVPSTETEALASNLMGMFEKRRFRKFLVFVANFDENDPKTFEGVDPQTTSMRDVYRKFDLGQDVIDFTGHALALYRTDDYLDQPCLETVNRIKLYSESLARYGKSPYLYPLYGLGELPQGFARLSAIYGGTYMLNKPVDDIIMENGKVVGVKSEGEVARCKQLICDPSYIPDRVRKAGQVIRIICILSHPIKNTNDANSCQIIIPQNQVNRKSDIYVCMISYAHNVAAQGKYIAIASTTVETTDPEKEVEPALELLEPIDQKFVAISDLYEPIDDGCESQVFCSCSYDATTHFETTCNDIKDIYKRMAGTAFDFENMKRKQNDVFGEAEQ tp4a1_human Protein tyrosine phosphatase type IVA 1 PTP4A1 PRL1 PTPCAAX1 PTP(CAAXI) Protein-tyrosine phosphatase 4a1 Protein-tyrosine phosphatase of regenerating liver 1 protein protein human Homo sapiens Human MARMNRPAPVEVTYKNMRFLITHNPTNATLNKFIEELKKYGVTTIVRVCEATYDTTLVEKEGIHVLDWPFDDGAPPSNQIVDDWLSLVKIKFREEPGCCIAVHCVAGLGRAPVLVALALIEGGMKYEDAVQFIRQKRRGAFNSKQLLYLEKYRPKMRLRFKDSNGHRNNCCIQ ikba_human NF-kappa-B inhibitor alpha NFKBIA IKBA MAD3 NFKBI I-kappa-B-alpha Major histocompatibility complex enhancer-binding protein MAD3 protein protein human Homo sapiens Human MFQAAERPQEWAMEGPRDGLKKERLLDDRHDSGLDSMKDEEYEQMVKELQEIRLEPQEVPRGSEPWKQQLTEDGDSFLHLAIIHEEKALTMEVIRQVKGDLAFLNFQNNLQQTPLHLAVITNQPEIAEALLGAGCDPELRDFRGNTPLHLACEQGCLASVGVLTQSCTTPHLHSILKATNYNGHTCLHLASIHGYLGIVELLVSLGADVNAQEPCNGRTALHLAVDLQNPDLVSLLLKCGADVNRVTYQGYSPYQLTWGRPSTRIQQQLGQLTLENLQMLPESEDEESYDTESEFTEFTEDELPYDDCVFGGQRLTL pi42c_human Phosphatidylinositol 5-phosphate 4-kinase type-2 gamma PIP4K2C PIP5K2C Phosphatidylinositol 5-phosphate 4-kinase type II gamma protein protein human Homo sapiens Human MASSSVPPATVSAATAGPGPGFGFASKTKKKHFVQQKVKVFRAADPLVGVFLWGVAHSINELSQVPPPVMLLPDDFKASSKIKVNNHLFHRENLPSHFKFKEYCPQVFRNLRDRFGIDDQDYLVSLTRNPPSESEGSDGRFLISYDRTLVIKEVSSEDIADMHSNLSNYHQYIVKCHGNTLLPQFLGMYRVSVDNEDSYMLVMRNMFSHRLPVHRKYDLKGSLVSREASDKEKVKELPTLKDMDFLNKNQKVYIGEEEKKIFLEKLKRDVEFLVQLKIMDYSLLLGIHDIIRGSEPEEEAPVREDESEVDGDCSLTGPPALVGSYGTSPEGIGGYIHSHRPLGPGEFESFIDVYAIRSAEGAPQKEVYFMGLIDILTQYDAKKKAAHAAKTVKHGAGAEISTVHPEQYAKRFLDFITNIFA cr3l2_human Cyclic AMP-responsive element-binding protein 3-like protein 2 CREB3L2 BBF2H7 BBF2 human homolog on chromosome 7 protein protein human Homo sapiens Human MEVLESGEQGVLQWDRKLSELSEPGDGEALMYHTHFSELLDEFSQNVLGQLLNDPFLSEKSVSMEVEPSPTSPAPLIQAEHSYSLCEEPRAQSPFTHITTSDSFNDDEVESEKWYLSTDFPSTSIKTEPVTDEPPPGLVPSVTLTITAISTPLEKEEPPLEMNTGVDSSCQTIIPKIKLEPHEVDQFLNFSPKEAPVDHLHLPPTPPSSHGSDSEGSLSPNPRLHPFSLPQTHSPSRAAPRAPSALSSSPLLTAPHKLQGSGPLVLTEEEKRTLIAEGYPIPTKLPLSKSEEKALKKIRRKIKNKISAQESRRKKKEYMDSLEKKVESCSTENLELRKKVEVLENTNRTLLQQLQKLQTLVMGKVSRTCKLAGTQTGTCLMVVVLCFAVAFGSFFQGYGPYPSATKMALPSQHSLQEPYTASVVRSRNLLIYEEHSPPEESSSPGSAGELGGWDRGSSLLRVSGLESRPDVDLPHFIISNETSLEKSVLLELQQHLVSAKLEGNETLKVVELDRRVNTTF phb2_human Prohibitin-2 BAP REA PHB2 D-prohibitin B-cell receptor-associated protein BAP37 Repressor of estrogen receptor activity protein protein human Homo sapiens Human MAQNLKDLAGRLPAGPRGMGTALKLLLGAGAVAYGVRESVFTVEGGHRAIFFNRIGGVQQDTILAEGLHFRIPWFQYPIIYDIRARPRKISSPTGSKDLQMVNISLRVLSRPNAQELPSMYQRLGLDYEERVLPSIVNEVLKSVVAKFNASQLITQRAQVSLLIRRELTERAKDFSLILDDVAITELSFSREYTAAVEAKQVAQQEAQRAQFLVEKAKQEQRQKIVQAEGEAEAAKMLGEALSKNPGYIKLRKIRAAQNISKTIATSQNRIYLTADNLVLNLQDESFTRGSDSLIKGKK rnd1_human Rho-related GTP-binding protein Rho6 RND1 RHO6 Rho family GTPase 1 Rnd1 protein protein human Homo sapiens Human MKERRAPQPVVARCKLVLVGDVQCGKTAMLQVLAKDCYPETYVPTVFENYTACLETEEQRVELSLWDTSGSPYYDNVRPLCYSDSDAVLLCFDISRPETVDSALKKWRTEILDYCPSTRVLLIGCKTDLRTDLSTLMELSHQKQAPISYEQGCAIAKQLGAEIYLEGSAFTSEKSIHSIFRTASMLCLNKPSPLPQKSPVRSLSKRLLHLPSRSELISSTFKKEKAKSCSIM mlx_human Max-like protein X Max-like bHLHZip protein BHLHD13 Protein BigMax Transcription factor-like protein 4 MLX TCFL4 Class D basic helix-loop-helix protein 13 protein protein human Homo sapiens Human MTEPGASPEDPWVKASPVGAHAGEGRAGRARARRGAGRRGASLLSPKSPTLSVPRGCREDSSHPACAKVEYAYSDNSLDPGLFVESTRKGSVVSRANSIGSTSASSVPNTDDEDSDYHQEAYKESYKDRRRRAHTQAEQKRRDAIKRGYDDLQTIVPTCQQQDFSIGSQKLSKAIVLQKTIDYIQFLHKEKKKQEEEVSTLRKDVTALKIMKVNYEQIVKAHQDNPHEGEDQVSDQVKFNVFQGIMDSLFQSFNASISVASFQELSACVFSWIEEHCKPQTLREIVIGVLHQLKNQLY dus6_human Dual specificity protein phosphatase 6 Mitogen-activated protein kinase phosphatase 3 Dual specificity protein phosphatase PYST1 DUSP6 MKP3 PYST1 protein protein human Homo sapiens Human MIDTLRPVPFASEMAISKTVAWLNEQLELGNERLLLMDCRPQELYESSHIESAINVAIPGIMLRRLQKGNLPVRALFTRGEDRDRFTRRCGTDTVVLYDESSSDWNENTGGESVLGLLLKKLKDEGCRAFYLEGGFSKFQAEFSLHCETNLDGSCSSSSPPLPVLGLGGLRISSDSSSDIESDLDRDPNSATDSDGSPLSNSQPSFPVEILPFLYLGCAKDSTNLDVLEEFGIKYILNVTPNLPNLFENAGEFKYKQIPISDHWSQNLSQFFPEAISFIDEARGKNCGVLVHCLAGISRSVTVTVAYLMQKLNLSMNDAYDIVKMKKSNISPNFNFMGQLLDFERTLGLSSPCDNRVPAQQLYFTTPSNQNVYQVDSLQST hbp1_human HMG box-containing protein 1 HMG box transcription factor 1 High mobility group box transcription factor 1 HBP1 protein protein human Homo sapiens Human MVWEVKTNQMPNAVQKLLLVMDKRASGMNDSLELLQCNENLPSSPGYNSCDEHMELDDLPELQAVQSDPTQSGMYQLSSDVSHQEYPRSSWNQNTSDIPETTYRENEVDWLTELANIATSPQSPLMQCSFYNRSSPVHIIATSKSLHSYARPPPVSSSSKSEPAFPHHHWKEETPVRHERANSESESGIFCMSSLSDDDDLGWCNSWPSTVWHCFLKGTRLCFHKGSNKEWQDVEDFARAEGCDNEEDLQMGIHKGYGSDGLKLLSHEESVSFGESVLKLTFDPGTVEDGLLTVECKLDHPFYVKNKGWSSFYPSLTVVQHGIPCCEVHIGDVCLPPGHPDAINFDDSGVFDTFKSYDFTPMDSSAVYVLSSMARQRRASLSCGGPGGQDFARSGFSKNCGSPGSSQLSSNSLYAKAVKNHSSGTVSATSPNKCKRPMNAFMLFAKKYRVEYTQMYPGKDNRAISVILGDRWKKMKNEERRMYTLEAKALAEEQKRLNPDCWKRKRTNSGSQQH nkx23_human Homeobox protein Nkx-2.3 NKX2-3 NKX23 NKX2C Homeobox protein NK-2 homolog C protein protein human Homo sapiens Human MMLPSPVTSTPFSVKDILNLEQQHQHFHGAHLQADLEHHFHSAPCMLAAAEGTQFSDGGEEDEEDEGEKLSYLNSLAAADGHGDSGLCPQGYVHTVLRDSCSEPKEHEEEPEVVRDRSQKSCQLKKSLETAGDCKAAEESERPKPRSRRKPRVLFSQAQVFELERRFKQQRYLSAPEREHLASSLKLTSTQVKIWFQNRRYKCKRQRQDKSLELGAHAPPPPPRRVAVPVLVRDGKPCVTPSAQAYGAPYSVGASAYSYNSFPAYGYGNSAAAAAAAAAAAAAAAAYSSSYGCAYPAGGGGGGGGTSAATTAMQPACSAAGGGPFVNVSNLGGFGSGGSAQPLHQGTAAGAACAQGTLQGIRAW znf3_human Zinc finger protein 3 ZNF3 KOX25 Zinc finger protein KOX25 Zinc finger protein HF.12 Zinc finger protein HZF3.1 protein protein human Homo sapiens Human METQADLVSQEPQALLDSALPSKVPAFSDKDSLGDEMLAAALLKAKSQELVTFEDVAVYFIRKEWKRLEPAQRDLYRDVMLENYGNVFSLDRETRTENDQEISEDTRSHGVLLGRFQKDISQGLKFKEAYEREVSLKRPLGNSPGERLNRKMPDFGQVTVEEKLTPRGERSEKYNDFGNSFTVNSNLISHQRLPVGDRPHKCDECSKSFNRTSDLIQHQRIHTGEKPYECNECGKAFSQSSHLIQHQRIHTGEKPYECSDCGKTFSCSSALILHRRIHTGEKPYECNECGKTFSWSSTLTHHQRIHTGEKPYACNECGKAFSRSSTLIHHQRIHTGEKPYECNECGKAFSQSSHLYQHQRIHTGEKPYECMECGGKFTYSSGLIQHQRIHTGENPYECSECGKAFRYSSALVRHQRIHTGEKPLNGIGMSKSSLRVTTELNIREST atf3-atf3 ATF3 forms homo-oligomers in a yeast two-hybrid assay 727421 N/A 727424 unspecified role unspecified role bait bait N/A 727424 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. II Fig. 1, Table 1 BAIT gene NM_001030287; PREY gene NM_001030287 II atf3-fhl2 ATF3 interacts with FHL2 in a yeast two-hybrid assay 727421 N/A 727425 unspecified role unspecified role prey prey N/A 727424 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. III Fig. 1, Table 1 BAIT gene NM_001030287; PREY gene NM_001450 III atf3-id3 ATF3 interacts with ID3 in a yeast two-hybrid assay 727421 N/A 727426 unspecified role unspecified role prey prey N/A 727424 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. II Fig. 1, Table 1 BAIT gene NM_001030287; PREY gene NM_002167 II atf4-znf212 ATF4 interacts with ZNF212 in a yeast two-hybrid assay 727421 N/A 727427 unspecified role unspecified role bait bait N/A 727428 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. I Fig. 1, Table 1 BAIT gene NM_001675; PREY gene NM_012256 The ORF of ZNF212 used in this study encoded a truncated protein product missing the C-terminal end. I cnot3-id3 CNOT3 interacts with ID3 in a yeast two-hybrid assay 727421 N/A 727426 unspecified role unspecified role prey prey N/A 727429 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. II Fig. 1, Table 1 BAIT gene NM_014516; PREY gene NM_002167 The ORF of CNOT3 used in this study encoded a truncated protein product missing the C-terminal end. II csk-id3 CSK interacts with ID3 in a yeast two-hybrid assay 727421 N/A 727430 unspecified role unspecified role bait bait N/A 727426 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. II Fig. 1, Table 1 BAIT gene NM_004383; PREY gene NM_002167 The ORF of CSK used in this study encoded a truncated protein product missing the C-terminal end. II dpf2-fhl2 DPF2 interacts with FHL2 in a yeast two-hybrid assay 727421 N/A 727425 unspecified role unspecified role prey prey N/A 727431 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. I Fig. 1, Table 1 BAIT gene NM_006268; PREY gene NM_001450 I fhl2-atf3 FLH2 interacts with ATF3 in a yeast two-hybrid assay 727421 N/A 727424 unspecified role unspecified role prey prey N/A 727425 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. IV Fig. 1, Table 1 BAIT gene NM_001450; PREY gene NM_001030287 IV fhl2-csk FLH2 interacts with CSK in a yeast two-hybrid assay 727421 N/A 727430 unspecified role unspecified role prey prey N/A 727425 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. IV Fig. 1, Table 1 BAIT gene NM_001450; PREY gene NM_004383 The ORF of CSK used in this study encoded a truncated protein product missing the C-terminal end. IV fhl2-dpf2 FLH2 interacts with DPF2 in a yeast two-hybrid assay 727421 N/A 727425 unspecified role unspecified role bait bait n/a 727431 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. I Fig. 1, Table 1 BAIT gene NM_001450; PREY gene NM_006268 I fhl2-sap30bp FLH2 interacts with HCNGP in a yeast two-hybrid assay 727421 N/A 727432 unspecified role unspecified role prey prey N/A 727425 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. IV Fig. 1, Table 1 BAIT gene NM_001450; PREY gene NM_013260 IV fhl2-id3 FLH2 interacts with ID3 in a yeast two-hybrid assay 727421 N/A 727425 unspecified role unspecified role bait bait N/A 727426 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. IV Fig. 1, Table 1 BAIT gene NM_001450; PREY gene NM_002167 IV fhl2-puf60 FLH2 interacts with SIAHBP1 in a yeast two-hybrid assay 727421 N/A 727433 unspecified role unspecified role prey prey N/A 727425 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. IV Fig. 1, Table 1 BAIT gene NM_001450; PREY gene NM_014281 IV fhl2-stat3 FLH2 interacts with STAT3 in a yeast two-hybrid assay 727421 N/A 727425 unspecified role unspecified role bait bait N/A 727434 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. I Fig. 1, Table 1 BAIT gene NM_001450; PREY gene NM_003150 I fhl2-znf331 FLH2 interacts with ZNF331 in a yeast two-hybrid assay 727421 N/A 727435 unspecified role unspecified role prey prey N/A 727425 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. II Fig. 1, Table 1 BAIT gene NM_001450; PREY gene NM_018555 II fhl2-znf408 FLH2 interacts with ZNF408 in a yeast two-hybrid assay 727421 N/A 727425 unspecified role unspecified role bait bait N/A 727436 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. IV Fig. 1, Table 1 BAIT gene NM_001450; PREY gene NM_024741 The ORF of ZNF408 used in this study encoded a truncated protein product missing the C-terminal end. IV fhl2-znf626 FLH2 interacts with ZNF626 in a yeast two-hybrid assay 727421 N/A 727437 unspecified role unspecified role prey prey N/A 727425 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. III Fig. 1, Table 1 BAIT gene NM_001450; PREY gene NM_145297 The ORF of ZNF626 used in this study encoded a truncated protein product missing the C-terminal end. III fhl2-znfn1a4 FLH2 interacts with ZNFN1A4 in a yeast two-hybrid assay 727421 N/A 727438 unspecified role unspecified role prey prey N/A 727425 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. II Fig. 1, Table 1 BAIT gene NM_001450; PREY gene NM_022465 The ORF of ZNFN1A4 used in this study encoded a truncated protein product missing the C-terminal end. II gnb2-id3 GNB2 interacts with ID3 in a yeast two-hybrid assay 727421 N/A 727439 unspecified role unspecified role bait bait N/A 727426 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. II Fig. 1, Table 1 BAIT gene NM_005273; PREY gene NM_002167 II gnl1-gdi1 GNL1 interacts with GDI1 in a yeast two-hybrid assay 727421 N/A 727440 unspecified role unspecified role bait bait N/A 727441 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. I Fig. 1, Table 1 BAIT gene NM_005275; PREY gene NM_001493 I gnl1-ptp4a1 GNL1 interacts with PTP4A1 in a yeast two-hybrid assay 727421 N/A 727440 unspecified role unspecified role bait bait n/a 727442 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. II Fig. 1, Table 1 BAIT gene NM_005275; PREY gene NM_003463 II sap30bp-puf60 HCNGP interacts with SIAHBP1 in a yeast two-hybrid assay 727421 N/A 727432 unspecified role unspecified role bait bait N/A 727433 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. II Fig. 1, Table 1 BAIT gene NM_013260; PREY gene NM_014281 II fhl2-flh2 FLH2 forms homo-oligomers in a yeast two-hybrid assay 727421 N/A 727425 unspecified role unspecified role prey prey N/A 727425 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. IV Fig. 1, Table 1 BAIT gene NM_001450; PREY gene NM_001450 IV id3-id3 ID3 forms homo-oligomers in a yeast two-hybrid assay 727421 N/A 727426 unspecified role unspecified role bait bait N/A 727426 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. III Fig. 1, Table 1 BAIT gene NM_002167; PREY gene NM_002167 III nfkbia-atf4 NFKBIA interacts with ATF4 in a yeast two-hybrid assay 727421 N/A 727443 unspecified role unspecified role bait bait N/A 727427 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. I Fig. 1, Table 1 BAIT gene NM_020529; PREY gene NM_001675 I pip4k2c-pip4k2c PIP5K2C forms homo-oligomers in a yeast two-hybrid assay 727421 N/A 727444 unspecified role unspecified role prey prey N/A 727444 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. I Fig. 1, Table 1 BAIT gene NM_024779; PREY gene NM_024779 I ptp4a1-creb3l2 PTP4A1 interacts with CREB3L2 in a yeast two-hybrid assay 727421 N/A 727445 unspecified role unspecified role prey prey n/a 727442 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. IV Fig. 1, Table 1 BAIT gene NM_003463; PREY gene NM_194071 IV phb2-fhl2 REA interacts with FHL2 in a yeast two-hybrid assay 727421 N/A 727425 unspecified role unspecified role prey prey N/A 727446 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. I Fig. 1, Table 1 BAIT gene NM_007273; PREY gene NM_001450 I rnd1-creb3l2 RHO6 interacts with CREB3L2 in a yeast two-hybrid assay 727421 N/A 727447 unspecified role unspecified role bait bait N/A 727445 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. III Fig. 1, Table 1 BAIT gene NM_014470; PREY gene NM_194071 III rnd1-id3 RHO6 interacts with ID3 in a yeast two-hybrid assay 727421 N/A 727426 unspecified role unspecified role prey prey N/A 727447 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. III Fig. 1, Table 1 BAIT gene NM_014470; PREY gene NM_002167 III puf60-sap30bp SIAHBP1 interacts HCNGP with in a yeast two-hybrid assay 727421 N/A 727433 unspecified role unspecified role bait bait N/A 727432 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. I Fig. 1, Table 1 BAIT gene NM_014281; PREY gene NM_013260 I puf60-id3 SIAHBP1 interacts with ID3 in a yeast two-hybrid assay 727421 N/A 727426 unspecified role unspecified role prey prey N/A 727433 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. III Fig. 1, Table 1 BAIT gene NM_014281; PREY gene NM_002167 III mlx-sap30bp TCFL4 interacts with HCNGP in a yeast two-hybrid assay 727421 N/A 727432 unspecified role unspecified role prey prey N/A 727448 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. IV Fig. 1, Table 1 BAIT gene NM_198205; PREY gene NM_013260 IV mlx-id3 TCFL4 interacts with ID3 in a yeast two-hybrid assay 727421 N/A 727448 unspecified role unspecified role bait bait N/A 727426 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. II Fig. 1, Table 1 BAIT gene NM_198205; PREY gene NM_002167 II znf212-atf3 ZNF212 interacts with ATF3 in a yeast two-hybrid assay 727421 N/A 727428 unspecified role unspecified role bait bait N/A 727424 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. II Fig. 1, Table 1 BAIT gene NM_012256; PREY gene NM_001030287 The ORF of ZNF212 used in this study encoded a truncated protein product missing the C-terminal end. II znf212-creb3l2 ZNF212 interacts with CREB3L2 in a yeast two-hybrid assay 727421 N/A 727445 unspecified role unspecified role prey prey N/A 727428 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. I Fig. 1, Table 1 BAIT gene NM_012256; PREY gene NM_194071 The ORF of ZNF212 used in this study encoded a truncated protein product missing the C-terminal end. I znf212-csk ZNF212 interacts with CSK in a yeast two-hybrid assay 727421 N/A 727430 unspecified role unspecified role prey prey N/A 727428 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. II Fig. 1, Table 1 BAIT gene NM_012256; PREY gene NM_004383 The ORFs of ZNF212 and CSK used in this study encoded truncated protein products missing the C-terminal end. II znf212-dpf2 ZNF212 interacts with DPF2 in a yeast two-hybrid assay 727421 N/A 727431 unspecified role unspecified role prey prey N/A 727428 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. IV Fig. 1, Table 1 BAIT gene NM_012256; PREY gene NM_006268 The ORF of ZNF212 used in this study encoded a truncated protein product missing the C-terminal end. IV znf212-dusp6 ZNF212 interacts with DUSP6 in a yeast two-hybrid assay 727421 N/A 727449 unspecified role unspecified role prey prey N/A 727428 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. II Fig. 1, Table 1 BAIT gene NM_012256; PREY gene NM_001946 The ORF of ZNF212 used in this study encoded a truncated protein product missing the C-terminal end. II znf212-fhl2 ZNF212 interacts with FHL2 in a yeast two-hybrid assay 727421 N/A 727425 unspecified role unspecified role prey prey N/A 727428 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. III Fig. 1, Table 1 BAIT gene NM_012256; PREY gene NM_001450 The ORF of ZNF212 used in this study encoded a truncated protein product missing the C-terminal end. III znf212-gnl1 ZNF212 interacts with GNL1 in a yeast two-hybrid assay 727421 N/A 727428 unspecified role unspecified role bait bait N/A 727440 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. II Fig. 1, Table 1 BAIT gene NM_012256; PREY gene NM_005275 The ORF of ZNF212 used in this study encoded a truncated protein product missing the C-terminal end. II znf212-hbp1 ZNF212 interacts with HBP1 in a yeast two-hybrid assay 727421 N/A 727450 unspecified role unspecified role prey prey N/A 727428 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. III Fig. 1, Table 1 BAIT gene NM_012256; PREY gene NM_012257 The ORFs of HBP1 and ZNF212 used in this study encoded truncated protein products missing the C-terminal end. III znf212-sap30bp ZNF212 interacts with HCNGP in a yeast two-hybrid assay 727421 N/A 727432 unspecified role unspecified role prey prey N/A 727428 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. II Fig. 1, Table 1 BAIT gene NM_012256; PREY gene NM_013260 The ORF of ZNF212 used in this study encoded a truncated protein product missing the C-terminal end. II znf212-nfkbia ZNF212 interacts with NFKBIA in a yeast two-hybrid assay 727421 N/A 727428 unspecified role unspecified role bait bait N/A 727443 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. IV Fig. 1, Table 1 BAIT gene NM_012256; PREY gene NM_020529 The ORF of ZNF212 used in this study encoded a truncated protein product missing the C-terminal end. IV znf212-ptp4a1 ZNF212 interacts with PTP4A1 in a yeast two-hybrid assay 727421 n/a 727442 unspecified role unspecified role prey prey N/A 727428 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. III Fig. 1, Table 1 BAIT gene NM_012256; PREY gene NM_003463 The ORF of ZNF212 used in this study encoded a truncated protein product missing the C-terminal end. III znf212-nkx2_3 ZNF212 interacts with NKX2-3 in a yeast two-hybrid assay 727421 N/A 727428 unspecified role unspecified role bait bait N/A 727451 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. IV Fig. 1, Table 1 BAIT gene NM_012256; PREY gene NM_145285 The ORF of ZNF212 used in this study encoded a truncated protein product missing the C-terminal end. IV znf212-rnd1 ZNF212 interacts with RHO6 in a yeast two-hybrid assay 727421 N/A 727447 unspecified role unspecified role prey prey N/A 727428 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. II Fig. 1, Table 1 BAIT gene NM_012256; PREY gene NM_014470 The ORF of ZNF212 used in this study encoded a truncated protein product missing the C-terminal end. II znf212-znf212 ZNF212 forms homo-oligomers in a yeast two-hybrid assay 727421 N/A 727428 unspecified role unspecified role bait bait N/A 727428 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. II Fig. 1, Table 1 BAIT gene NM_012256; PREY gene NM_012256 The ORF of ZNF212 used in this study encoded a truncated protein product missing the C-terminal end. II znf212-znf3 ZNF212 interacts with ZNF3 in a yeast two-hybrid assay 727421 N/A 727428 unspecified role unspecified role bait bait N/A 727452 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. II Fig. 1, Table 1 BAIT gene NM_012256; PREY gene NM_032924 The ORF of ZNF212 used in this study encoded a truncated protein product missing the C-terminal end. II znf212-znf331 ZNF212 interacts with ZNF331 in a yeast two-hybrid assay 727421 N/A 727435 unspecified role unspecified role prey prey N/A 727428 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. I Fig. 1, Table 1 BAIT gene NM_012256; PREY gene NM_018555 The ORF of ZNF212 used in this study encoded a truncated protein product missing the C-terminal end. I znf212-znf408 ZNF212 interacts with ZNF408 in a yeast two-hybrid assay 727421 N/A 727428 unspecified role unspecified role bait bait N/A 727436 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. IV Fig. 1, Table 1 BAIT gene NM_012256; PREY gene NM_024741 The ORFs of ZNF408 and ZNF212 used in this study encoded truncated protein products missing the C-terminal end. IV znf3-fhl2 ZNF3 interacts with FHL2 in a yeast two-hybrid assay 727421 N/A 727452 unspecified role unspecified role bait bait N/A 727425 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. II Fig. 1, Table 1 BAIT gene NM_032924; PREY gene NM_001450 II znf3-id3 ZNF3 interacts with ID3 in a yeast two-hybrid assay 727421 N/A 727426 unspecified role unspecified role prey prey N/A 727452 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. II Fig. 1, Table 1 BAIT gene NM_032924; PREY gene NM_002167 II znf3-znf212 ZNF3 interacts with ZNF212 in a yeast two-hybrid assay 727421 N/A 727428 unspecified role unspecified role prey prey N/A 727452 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. I Fig. 1, Table 1 BAIT gene NM_032924; PREY gene NM_012256 The ORF of ZNF212 used in this study encoded a truncated protein product missing the C-terminal end. I znf3-znf3 ZNF3 forms homo-oligomers in a yeast two-hybrid assay 727421 N/A 727452 unspecified role unspecified role bait bait N/A 727452 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. I Fig. 1, Table 1 BAIT gene NM_032924; PREY gene NM_032924 I znf331-fhl2 ZNF331 interacts with FHL2 in a yeast two-hybrid assay 727421 N/A 727435 unspecified role unspecified role bait bait N/A 727425 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. IV Fig. 1, Table 1 BAIT gene NM_018555; PREY gene NM_001450 IV znf408-fhl2 ZNF408 interacts with FHL2 in a yeast two-hybrid assay 727421 N/A 727436 unspecified role unspecified role bait bait N/A 727425 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. IV Fig. 1, Table 1 BAIT gene NM_024741; PREY gene NM_001450 The ORF of ZNF408 used in this study encoded a truncated protein product missing the C-terminal end. IV znf408-sap30bp ZNF408 interacts with HCNGP in a yeast two-hybrid assay 727421 N/A 727432 unspecified role unspecified role prey prey N/A 727436 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. I Fig. 1, Table 1 BAIT gene NM_024741; PREY gene NM_013260 The ORF of ZNF408 used in this study encoded a truncated protein product missing the C-terminal end. I znf331-znf408 ZNF331 interacts with ZNF408 in a yeast two-hybrid assay 727421 N/A 727436 unspecified role unspecified role prey prey N/A 727435 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. II Fig. 1, Table 1 BAIT gene NM_018555; PREY gene NM_024741 The ORF of ZNF408 used in this study encoded a truncated protein product missing the C-terminal end. II znf408-id3 ZNF408 interacts with ID3 in a yeast two-hybrid assay 727421 N/A 727436 unspecified role unspecified role bait bait N/A 727426 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. II Fig. 1, Table 1 BAIT gene NM_024741; PREY gene NM_002167 The ORF of ZNF408 used in this study encoded a truncated protein product missing the C-terminal end. II znf408-znf408-3 ZNF408 forms homo-oligomers in a yeast two-hybrid assay 727421 N/A 727436 unspecified role unspecified role bait bait N/A 727436 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. IV Fig. 1, Table 1 BAIT gene NM_024741; PREY gene NM_024741 The ORF of ZNF408 used in this study encoded a truncated protein product missing the C-terminal end. IV znf626-id3 ZNF626 interacts with ID3 in a yeast two-hybrid assay 727421 N/A 727426 unspecified role unspecified role prey prey N/A 727437 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. II Fig. 1, Table 1 BAIT gene NM_145297; PREY gene NM_002167 The ORF of ZNF626 used in this study encoded a truncated protein product missing the C-terminal end. II znfn1a4-fhl2 ZNFN1A4 interacts with FHL2 in a yeast two-hybrid assay 727421 N/A 727425 unspecified role unspecified role prey prey N/A 727438 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. III Fig. 1, Table 1 BAIT gene NM_022465; PREY gene NM_001450 The ORF of ZNFN1A4 used in this study encoded a truncated protein product missing the C-terminal end. III znfn1a4-nfkbia ZNFN1A4 interacts with NFKBIA in a yeast two-hybrid assay 727421 N/A 727443 unspecified role unspecified role prey prey N/A 727438 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. III Fig. 1, Table 1 BAIT gene NM_022465; PREY gene NM_020529 The ORF of ZNFN1A4 used in this study encoded a truncated protein product missing the C-terminal end. III pip4k2c-pip4k2c-1 PIP5K2C forms homo-oligomers in an in vitro pull down assay 727422 N/A 727444 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 727444 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false Fig. 3 BAIT gene NM_024779; PREY gene NM_024779 znf3-znf3-1 ZNF3 forms homo-oligomers in an in vitro pull down assay 727422 N/A 727452 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 727452 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false Fig. 3 BAIT gene NM_032924; PREY gene NM_032924 znf3-znf212-1 ZNF3 interacts with ZNF212 in an in vitro pull down assay 727422 N/A 727428 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 727452 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false Fig. 3 BAIT gene NM_032924; PREY gene NM_012256 atf3-atf3-1 ATF3 forms homo-oligomers in an in vitro pull down assay 727422 N/A 727424 unspecified role unspecified role bait bait ecoli Escherichia coli (strain K12) N/A 727424 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false Fig. 3 BAIT gene NM_001030287; PREY gene NM_001030287 znf212-znf3-1 ZNF3 interacts with ZNF212 in an in vitro pull down assay 727422 N/A 727452 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 727428 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false Fig. 3 BAIT gene NM_012256; PREY gene NM_032924 znf408-znf408-4 ZNF408 forms homo-oligomers in an in vitro pull down assay 727422 N/A 727436 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 727436 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false Fig. 3 BAIT gene NM_024741; PREY gene NM_024741 znf212-znf3-2 ZNF212 forms homo-oligomers in an in vitro pull down assay 727422 N/A 727428 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 727428 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false Fig. 3 BAIT gene NM_012256; PREY gene NM_012256 fhl2-znf408-1 ZNF408 coimmunoprecipitates with FHL2 in 293T lysates 727423 N/A 727425 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 727436 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 3 BAIT gene NM_001450; PREY gene NM_024741 fhl2-atf3-1 FLH2 coimmunoprecipitates ATF3 in 293T lysates 727423 N/A 727424 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 727425 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 3 BAIT gene NM_001450; PREY gene NM_001030287 fhl2-flh2-1 FLH2 forms homo-oligomers in 293T lysates 727423 N/A 727425 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 727425 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 3 BAIT gene NM_001450; PREY gene NM_001450 sap30bp-puf60-1 HCNGP coimmunoprecipitates SIAHBP1 in 293T lysates 727423 N/A 727433 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 727432 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 3 BAIT gene NM_013260; PREY gene NM_014281