IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ willis-2007-1 Apoptosis initiated when BH3 ligands engage multiple Bcl-2 homologs, not Bax or Bak. in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Willis S.N., Fletcher J.I., Kaufmann T., van Delft M.F., Chen L., Czabotar P.E., Ierino H., Lee E.F., Fairlie W.D., Bouillet P., Strasser A., Kluck R.M., Adams J.M., Huang D.C. Apoptosis - Interactions involving proteins with a function related to apoptosis huang_d@wehi.edu.au Science (0036-8075) 2007 Only protein-protein interactions imex curation willis-2007-2 Apoptosis initiated when BH3 ligands engage multiple Bcl-2 homologs, not Bax or Bak. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Willis S.N., Fletcher J.I., Kaufmann T., van Delft M.F., Chen L., Czabotar P.E., Ierino H., Lee E.F., Fairlie W.D., Bouillet P., Strasser A., Kluck R.M., Adams J.M., Huang D.C. Apoptosis - Interactions involving proteins with a function related to apoptosis huang_d@wehi.edu.au Science (0036-8075) 2007 Only protein-protein interactions imex curation willis-2007-4 Apoptosis initiated when BH3 ligands engage multiple Bcl-2 homologs, not Bax or Bak. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Willis S.N., Fletcher J.I., Kaufmann T., van Delft M.F., Chen L., Czabotar P.E., Ierino H., Lee E.F., Fairlie W.D., Bouillet P., Strasser A., Kluck R.M., Adams J.M., Huang D.C. Apoptosis - Interactions involving proteins with a function related to apoptosis huang_d@wehi.edu.au Science (0036-8075) 2007 Only protein-protein interactions imex curation willis-2007-3 Apoptosis initiated when BH3 ligands engage multiple Bcl-2 homologs, not Bax or Bak. mouse-thymus Mus musculus thymus thymus anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Willis S.N., Fletcher J.I., Kaufmann T., van Delft M.F., Chen L., Czabotar P.E., Ierino H., Lee E.F., Fairlie W.D., Bouillet P., Strasser A., Kluck R.M., Adams J.M., Huang D.C. Apoptosis - Interactions involving proteins with a function related to apoptosis huang_d@wehi.edu.au Science (0036-8075) 2007 Only protein-protein interactions imex curation b2l11_human Bcl-2-like protein 11 BCL2L11 BIM Bcl2-interacting mediator of cell death protein protein human Homo sapiens Human MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQAEPADMRPEIWIAQELRRIGDEFNAYYARRVFLNNYQAAEDHPRMVILRLLRYIVRLVWRMH bax_human Apoptosis regulator BAX BAX BCL2L4 Bcl-2-like protein 4 protein protein human Homo sapiens Human MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGTPTWQTVTIFVAGVLTASLTIWKKMG bid_human BH3-interacting domain death agonist p22 BID BID protein protein human Homo sapiens Human MDCEVNNGSSLRDECITNLLVFGFLQSCSDNSFRRELDALGHELPVLAPQWEGYDELQTDGNRSSHSRLGRIEADSESQEDIIRNIARHLAQVGDSMDRSIPPGLVNGLALQLRNTSRSEEDRNRDLATALEQLLQAYPRDMEKEKTMLVLALLLAKKVASHTPSLLRDVFHTTVNFINQNLRTYVRSLARNGMD bcl2_human Apoptosis regulator Bcl-2 BCL2 protein protein human Homo sapiens Human MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPAASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK q07817-1 Bcl-2-like protein 1 BCLX Apoptosis regulator Bcl-X BCL2L1 BCL2L Bcl-xL protein protein human Homo sapiens Human MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLADSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK mcl1_mouse Induced myeloid leukemia cell differentiation protein Mcl-1 homolog Bcl-2-related protein EAT/mcl1 Mcl1 protein protein mouse Mus musculus Mouse MFGLRRNAVIGLNLYCGGASLGAGGGSPAGARLVAEEAKARREGGGEAALLPGARVVARPPPVGAEDPDVTASAERRLHKSPGLLAVPPEEMAASAAAAIVSPEEELDGCEPEAIGKRPAVLPLLERVSEAAKSSGADGSLPSTPPPPEEEEDDLYRQSLEIISRYLREQATGSKDSKPLGEAGAAGRRALETLRRVGDGVQRNHETAFQGMLRKLDIKNEGDVKSFSRVMVHVFKDGVTNWGRIVTLISFGAFVAKHLKSVNQESFIEPLAETITDVLVRTKRDWLVKQRGWDGFVEFFHVQDLEGGIRNVLLAFAGVAGVGAGLAYLIR b2la1_mouse Bcl-2-related protein A1 Protein BFL-1 Hemopoietic-specific early response protein A1-A Bcl2a1 A1 Bcl2a1a Bfl1 protein protein mouse Mus musculus Mouse MAESELMHIHSLAEHYLQYVLQVPAFESAPSQACRVLQRVAFSVQKEVEKNLKSYLDDFHVESIDTARIIFNQVMEKEFEDGIINWGRIVTIFAFGGVLLKKLPQEQIALDVCAYKQVSSFVAEFIMNNTGEWIRQNGGWEDGFIKKFEPKSGWLTFLQMTGQIWEMLFLLK b2cl2_human Bcl-2-like protein 2 Apoptosis regulator Bcl-W BCL2L2 BCLW KIAA0271 protein protein human Homo sapiens Human MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETQLADWIHSSGGWAEFTALYGDGALEEARRLREGNWASVRTVLTGAVALGALVTVGAFFASK bak_human Bcl-2 homologous antagonist/killer Apoptosis regulator BAK Bcl-2-like protein 7 BAK1 BAK BCL2L7 CDN1 protein protein human Homo sapiens Human MASGQGPGPPRQECGEPALPSASEEQVAQDTEEVFRSYVFYRHQQEQEAEGVAAPADPEMVTLPLQPSSTMGQVGRQLAIIGDDINRRYDSEFQTMLQHLQPTAENAYEYFTKIATSLFESGINWGRVVALLGFGYRLALHVYQHGLTGFLGQVTRFVVDFMLHHCIARWIAQRGGWVAALNLGNGPILNVLVVLGVVLLGQFVVRRFFKS o43521-1 Bcl-2-like protein 11 Bim(EL) BCL2L11 BIM Bcl2-interacting mediator of cell death protein protein human Homo sapiens Human MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQAEPADMRPEIWIAQELRRIGDEFNAYYARRVFLNNYQAAEDHPRMVILRLLRYIVRLVWRMH o43521-2 Bcl-2-like protein 11 Bim(L) BCL2L11 BIM Bcl2-interacting mediator of cell death protein protein human Homo sapiens Human MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQAEPADMRPEIWIAQELRRIGDEFNAYYARRVFLNNYQAAEDHPRMVILRLLRYIVRLVWRMH o43521-3 Bcl-2-like protein 11 Bim(S) BCL2-like 11 transcript variant 9 BCL2L11 BIM Bcl2-interacting mediator of cell death protein protein human Homo sapiens Human MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQASMRQAEPADMRPEIWIAQELRRIGDEFNAYYARRVFLNNYQAAEDHPRMVILRLLRYIVRLVWRMH o43521-4 Bcl-2-like protein 11 BimABCD Bim-ABCD BCL2L11 BIM Bcl2-interacting mediator of cell death protein protein human Homo sapiens Human MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQAEPADMRPEIWIAQELRRIGDEFNAYYARRLEK o43521-5 Bcl-2-like protein 11 BCL2L11 BIM Bcl2-interacting mediator of cell death Bim-ACD BimACD protein protein human Homo sapiens Human MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQAEPADMRPEIWIAQELRRIGDEFNAYYARRLEK o43521-6 Bcl-2-like protein 11 BCL2-like 11 transcript variant 10 BCL2L11 BIM Bcl2-interacting mediator of cell death Bim-AD BimAD protein protein human Homo sapiens Human MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQASMRQAEPADMRPEIWIAQELRRIGDEFNAYYARRLEK bik_human Bcl-2-interacting killer Apoptosis inducer NBK BP4 BIP1 BIK NBK protein protein human Homo sapiens Human MSEVRPLSRDILMETLLYEQLLEPPTMEVLGMTDSEEDLDPMEDFDSLECMEGSDALALRLACIGDEMDVSLRAPRLAQLSEVAMHSLGLAFIYDQTEDIRDVLRSFMDGFTTLKENIMRFWRSPNPGSWVSCEQVLLALLLLLALLLPLLSGGLHLLLK bmf_human Bcl-2-modifying factor BMF protein protein human Homo sapiens Human MEPSQCVEELEDDVFQPEDGEPVTQPGSLLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPIGEQPPEGQWQHQAEVQIARKLQCIADQFHRLHVQQHQQNQNRVWWQILLFLHNLALNGEENRNGAGPR bad_mouse Bcl2-associated agonist of cell death Bad Bbc6 Bcl-2-binding component 6 Bcl-xL/Bcl-2-associated death promoter Bcl2 antagonist of cell death protein protein mouse Mus musculus Mouse MGTPKQPSLAPAHALGLRKSDPGIRSLGSDAGGRRWRPAAQSMFQIPEFEPSEQEDASATDRGLGPSLTEDQPGPYLAPGLLGSNIHQQGRAATNSHHGGAGAMETRSRHSSYPAGTEEDEGMEEELSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFEGSFKGLPRPKSAGTATQMRQSAGWTRIIQSWWDRNLGKGGSTPSQ bbc3_human Bcl-2-binding component 3, isoforms 1/2 p53 up-regulated modulator of apoptosis JFY-1 BBC3 PUMA protein protein human Homo sapiens Human MARARQEGSSPEPVEGLARDGPRPFPLGRLVPSAVSCGLCEPGLAAAPAAPTLLPAAYLCAPTAPPAVTAALGGSRWPGGPRSRPRGPRPDGPQPSLSLAEQHLESPVPSAPGALAGGPTQAAPGVRGEEEQWAREIGAQLRRMADDLNAQYERRRQEEQQRHRPSPWRVLYNLIMGLLPLPRGHRAPEMEPN bcl2_mouse Apoptosis regulator Bcl-2 Bcl2 Bcl-2 protein protein mouse Mus musculus Mouse MAQAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDADAAPLGAAPTPGIFSFQPESNPMPAVHRDMAARTSPLRPLVATAGPALSPVPPVVHLTLRRAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK b2l11_mouse Bcl-2-like protein 11 Bcl2-interacting mediator of cell death Bcl2l11 Bim protein protein mouse Mus musculus Mouse MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEPQGNPDGEGDRCPHGSPQGPLAPPASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASIRQSQEEPEDLRPEIRIAQELRRIGDEFNETYTRRVFANDYREAEDHPQMVILQLLRFIFRLVWRRH bcl2l11-bax 1268891 n/a 1268895 unspecified role unspecified role bait bait purified purified bim 26 mer peptide sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false chemical synthesis Chemical synthesis (Chemical synthesis) n/a 1268896 unspecified role unspecified role prey prey purified purified ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false S1a This interaction happens with a de-natured from of Bax. The natively folded form of Bax did not show interaction in this experimental conditions. bid-bax-1 1268891 n/a 1268897 unspecified role unspecified role bait bait purified purified bid 34 mer peptide sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false chemical synthesis Chemical synthesis (Chemical synthesis) n/a 1268896 unspecified role unspecified role prey prey purified purified ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false S1a This interaction happens with a de-natured from of Bax. The natively folded form of Bax did not show interaction in this experimental conditions. bim-bcl2 1268891 n/a 1268898 competitor competitor competitor prey prey purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) n/a 1268896 unspecified role unspecified role prey prey purified purified ecoli Escherichia coli (strain K12) n/a 1268895 unspecified role unspecified role bait bait purified purified bim 26 mer peptide sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association false false false 1268891 S1c This interaction happens with a de-natured from of Bax. The natively folded form of Bax did not show interaction in this experimental conditions. bim-bclxl 1268891 n/a 1268896 unspecified role unspecified role prey prey purified purified ecoli Escherichia coli (strain K12) n/a 1268895 unspecified role unspecified role bait bait purified purified bim 26 mer peptide sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false chemical synthesis Chemical synthesis (Chemical synthesis) n/a 1268899 competitor competitor competitor prey prey purified purified gplgs residual tag tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) physical association physical association false false false 1268891 S1c This interaction happens with a de-natured from of Bax. The natively folded form of Bax did not show interaction in this experimental conditions. bim-mcl1 1268891 n/a 1268895 unspecified role unspecified role bait bait purified purified bim 26 mer peptide sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false chemical synthesis Chemical synthesis (Chemical synthesis) n/a 1268896 unspecified role unspecified role prey prey purified purified ecoli Escherichia coli (strain K12) n/a 1268900 competitor competitor competitor prey prey purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false gplgs residual tag tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) physical association physical association false false false 1268891 S1c This interaction happens with a de-natured from of Bax. The natively folded form of Bax did not show interaction in this experimental conditions. bim-a1 1268891 n/a 1268895 unspecified role unspecified role bait bait purified purified bim 26 mer peptide sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false chemical synthesis Chemical synthesis (Chemical synthesis) n/a 1268901 competitor competitor competitor prey prey purified purified gplgs residual tag tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) n/a 1268896 unspecified role unspecified role prey prey purified purified ecoli Escherichia coli (strain K12) physical association physical association false false false 1268891 S1c This interaction happens with a de-natured from of Bax. The natively folded form of Bax did not show interaction in this experimental conditions. bim-bclw 1268891 n/a 1268896 unspecified role unspecified role prey prey purified purified ecoli Escherichia coli (strain K12) n/a 1268895 unspecified role unspecified role bait bait purified purified bim 26 mer peptide sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false chemical synthesis Chemical synthesis (Chemical synthesis) n/a 1268902 competitor competitor competitor prey prey purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Q92843:p.[Cys29Ser;Ala128Leu] mutation mutation certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) physical association physical association false false false 1268891 S1c This interaction happens with a de-natured from of Bax. The natively folded form of Bax did not show interaction in this experimental conditions. bid24-bcl2 1268891 n/a 1268897 unspecified role unspecified role bait bait purified purified bid 24 mer peptide sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false chemical synthesis Chemical synthesis (Chemical synthesis) n/a 1268896 unspecified role unspecified role prey prey purified purified ecoli Escherichia coli (strain K12) n/a 1268898 competitor competitor competitor prey prey purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) physical association physical association false false false 1268891 S1c This interaction happens with a de-natured from of Bax. The natively folded form of Bax did not show interaction in this experimental conditions. bid24-bclxl 1268891 n/a 1268899 competitor competitor competitor prey prey purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false gplgs residual tag tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) n/a 1268896 unspecified role unspecified role prey prey purified purified ecoli Escherichia coli (strain K12) n/a 1268897 unspecified role unspecified role bait bait purified purified bid 24 mer peptide sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association false false false 1268891 S1c This interaction happens with a de-natured from of Bax. The natively folded form of Bax did not show interaction in this experimental conditions. bid34-bcl2 1268891 n/a 1268898 competitor competitor competitor prey prey purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) n/a 1268896 unspecified role unspecified role prey prey purified purified ecoli Escherichia coli (strain K12) n/a 1268897 unspecified role unspecified role bait bait purified purified bid 34 mer peptide sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association false false false 1268891 S1c This interaction happens with a de-natured from of Bax. The natively folded form of Bax did not show interaction in this experimental conditions. bid34-bclxl 1268891 n/a 1268897 unspecified role unspecified role bait bait purified purified bid 34 mer peptide sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false chemical synthesis Chemical synthesis (Chemical synthesis) n/a 1268899 competitor competitor competitor prey prey purified purified gplgs residual tag tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) n/a 1268896 unspecified role unspecified role prey prey purified purified ecoli Escherichia coli (strain K12) physical association physical association false false false 1268891 S1c This interaction happens with a de-natured from of Bax. The natively folded form of Bax did not show interaction in this experimental conditions. bid34-bclw 1268891 n/a 1268896 unspecified role unspecified role prey prey purified purified ecoli Escherichia coli (strain K12) n/a 1268897 unspecified role unspecified role bait bait purified purified bid 34 mer peptide sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false chemical synthesis Chemical synthesis (Chemical synthesis) n/a 1268902 competitor competitor competitor prey prey purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Q92843:p.[Cys29Ser;Ala128Leu] mutation mutation certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) physical association physical association false false false 1268891 S1c This interaction happens with a de-natured from of Bax. The natively folded form of Bax did not show interaction in this experimental conditions. bid24-bclw 1268891 n/a 1268897 unspecified role unspecified role bait bait purified purified bid 24 mer peptide sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false chemical synthesis Chemical synthesis (Chemical synthesis) n/a 1268896 unspecified role unspecified role prey prey purified purified ecoli Escherichia coli (strain K12) n/a 1268902 competitor competitor competitor prey prey purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Q92843:p.[Cys29Ser;Ala128Leu] mutation mutation certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) physical association physical association false false false 1268891 S1c This interaction happens with a de-natured from of Bax. The natively folded form of Bax did not show interaction in this experimental conditions. bid34-mcl1 1268891 n/a 1268897 unspecified role unspecified role bait bait purified purified bid 34 mer peptide sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false chemical synthesis Chemical synthesis (Chemical synthesis) n/a 1268900 competitor competitor competitor prey prey purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false gplgs residual tag tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) n/a 1268896 unspecified role unspecified role prey prey purified purified ecoli Escherichia coli (strain K12) physical association physical association false false false 1268891 S1c This interaction happens with a de-natured from of Bax. The natively folded form of Bax did not show interaction in this experimental conditions. bid24-mcl1 1268891 n/a 1268896 unspecified role unspecified role prey prey purified purified ecoli Escherichia coli (strain K12) n/a 1268897 unspecified role unspecified role bait bait purified purified bid 24 mer peptide sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false chemical synthesis Chemical synthesis (Chemical synthesis) n/a 1268900 competitor competitor competitor prey prey purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false gplgs residual tag tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) physical association physical association false false false 1268891 S1c This interaction happens with a de-natured from of Bax. The natively folded form of Bax did not show interaction in this experimental conditions. bid34-a1 1268891 n/a 1268896 unspecified role unspecified role prey prey purified purified ecoli Escherichia coli (strain K12) n/a 1268901 competitor competitor competitor prey prey purified purified gplgs residual tag tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) n/a 1268897 unspecified role unspecified role bait bait purified purified bid 34 mer peptide sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association false false false 1268891 S1c This interaction happens with a de-natured from of Bax. The natively folded form of Bax did not show interaction in this experimental conditions. bid24-a1 1268891 n/a 1268896 unspecified role unspecified role prey prey purified purified ecoli Escherichia coli (strain K12) n/a 1268901 competitor competitor competitor prey prey purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false gplgs residual tag tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) n/a 1268897 unspecified role unspecified role bait bait purified purified bid 24 mer peptide sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association false false false 1268891 S1c This interaction happens with a de-natured from of Bax. The natively folded form of Bax did not show interaction in this experimental conditions. bid-bax-2 1268891 n/a 1268897 competitor competitor competitor prey prey purified purified bid 34 mer peptide sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false chemical synthesis Chemical synthesis (Chemical synthesis) n/a 1268897 unspecified role unspecified role bait bait purified purified bid 34 mer peptide sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false chemical synthesis Chemical synthesis (Chemical synthesis) n/a 1268896 unspecified role unspecified role prey prey purified purified ecoli Escherichia coli (strain K12) physical association physical association false false false 1268891 1b This interaction happens with a de-natured from of Bax. The natively folded form of Bax did not show interaction in this experimental conditions. IC50 ranges from 2 to 10 microM. bcl2l11-bax-2 1268891 n/a 1268895 competitor competitor competitor prey prey purified purified bim 26 mer peptide sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false chemical synthesis Chemical synthesis (Chemical synthesis) n/a 1268896 unspecified role unspecified role prey prey purified purified ecoli Escherichia coli (strain K12) n/a 1268895 unspecified role unspecified role bait bait purified purified bim 26 mer peptide sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association false false false 1268891 1b This interaction happens with a de-natured from of Bax. The natively folded form of Bax did not show interaction in this experimental conditions. bax-bak1 1268892 n/a 1268898 unspecified role unspecified role prey prey n/a 1268896 unspecified role unspecified role prey prey n/a 1268903 unspecified role unspecified role prey prey n/a 1268896 unspecified role unspecified role bait bait ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false S4a, S4b and S4c Treatment with Triton X-100 (exposes hydrophobic residues in Bax) is required for the interaction with Bcl2 to happen. Very low interaction with Bcl2 coudl be detected upon treatment with CHAPS. The rest of the preys interacted independently of this treatment. bax-bak1-1 1268892 n/a 1268896 unspecified role unspecified role prey prey n/a 1268896 unspecified role unspecified role bait bait ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1268903 unspecified role unspecified role prey prey association association false false false S4a, S4b and S4c bid-bax-3 1268892 n/a 1268896 unspecified role unspecified role prey prey n/a 1268898 unspecified role unspecified role prey prey n/a 1268897 unspecified role unspecified role bait bait ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false tbid region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false association association false false false S4a Treatment with T-X100 (exposes hydrophobic residues in Bax) is required for the interaction with Bax to happen. bid-bax-4 1268892 n/a 1268898 unspecified role unspecified role prey prey n/a 1268897 unspecified role unspecified role bait bait tbid region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false S4a bcl2l11-bcl2-4 1268892 n/a 1268898 unspecified role unspecified role prey prey n/a 1268904 unspecified role unspecified role bait bait ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false S4b bcl2l11-bcl2-5 1268892 n/a 1268898 unspecified role unspecified role prey prey n/a 1268905 unspecified role unspecified role bait bait ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false S4b bcl2l11-bax-3 1268892 n/a 1268906 unspecified role unspecified role bait bait ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1268898 unspecified role unspecified role prey prey n/a 1268896 unspecified role unspecified role prey prey association association false false false S4b Treatment with Triton X-100 (exposes hydrophobic residues in Bax) is required for the interaction with Bax to happen. bcl2l11-bax-4 1268892 n/a 1268896 unspecified role unspecified role prey prey n/a 1268898 unspecified role unspecified role prey prey n/a 1268907 unspecified role unspecified role bait bait ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false S4b Treatment with Triton X-100 (exposes hydrophobic residues in Bax) is required for the interaction with Bax to happen. bcl2l11-bax-5 1268892 n/a 1268908 unspecified role unspecified role bait bait ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1268898 unspecified role unspecified role prey prey n/a 1268896 unspecified role unspecified role prey prey association association false false false S4b Treatment with Triton X-100 (exposes hydrophobic residues in Bax) is required for the interaction with Bax to happen. bcl2l11-bax-6 1268892 n/a 1268909 unspecified role unspecified role bait bait ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1268898 unspecified role unspecified role prey prey n/a 1268896 unspecified role unspecified role prey prey association association false false false S4b Treatment with Triton X-100 (exposes hydrophobic residues in Bax) is required for the interaction with Bax to happen. bik-bcl2-2 1268892 n/a 1268910 unspecified role unspecified role bait bait ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1268898 unspecified role unspecified role prey prey physical association physical association false false false S4c bmf-bcl2 1268892 n/a 1268898 unspecified role unspecified role prey prey n/a 1268911 unspecified role unspecified role bait bait ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false S4c bad-bcl2 1268892 n/a 1268912 unspecified role unspecified role bait bait ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1268898 unspecified role unspecified role prey prey physical association physical association false false false S4c bbc3-bcl2 1268892 n/a 1268913 unspecified role unspecified role bait bait ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1268898 unspecified role unspecified role prey prey physical association physical association false false false S4c bid-bcl2-1 1268892 n/a 1268899 unspecified role unspecified role prey prey n/a 1268898 unspecified role unspecified role prey prey n/a 1268900 unspecified role unspecified role prey prey n/a 1268902 unspecified role unspecified role prey prey n/a 1268896 unspecified role unspecified role prey prey n/a 1268897 unspecified role unspecified role bait bait ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false P55957:p.Gly94Ala mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false P55957:p.Gly94Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false tbid region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false P55957:p.Gly94Glu mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false association association false false false 2a bims-bcl2-1 1268892 n/a 1268906 unspecified role unspecified role bait bait ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false O43521-3:p.Gly66Ala mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false O43521-3:p.Gly66Glu mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false n/a 1268900 unspecified role unspecified role prey prey n/a 1268902 unspecified role unspecified role prey prey n/a 1268899 unspecified role unspecified role prey prey n/a 1268896 unspecified role unspecified role prey prey n/a 1268898 unspecified role unspecified role prey prey association association false false false S8a bax-bcl2-1 1268893 n/a 1268896 unspecified role unspecified role bait bait Q07812:p.Lys64Ala mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1268898 unspecified role unspecified role prey prey flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false S15a and S15b bcl2-bax-5 1268893 n/a 1268898 unspecified role unspecified role bait bait flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1268896 unspecified role unspecified role prey prey Q07812:p.Lys64Ala mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false S15a and S15b bax-bcxl 1268893 n/a 1268899 unspecified role unspecified role prey prey flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1268896 unspecified role unspecified role bait bait ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false S15a and S15b bcl2l1-bax-2 1268893 n/a 1268899 unspecified role unspecified role bait bait flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1268896 unspecified role unspecified role prey prey ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false S15a and S15b bcl2l2-bax-3 1268893 n/a 1268896 unspecified role unspecified role prey prey ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1268902 unspecified role unspecified role bait bait flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false S15a and S15b bax-bcl2l2-1 1268893 n/a 1268902 unspecified role unspecified role prey prey flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1268896 unspecified role unspecified role bait bait ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false S15a and S15b bax-mcl1 1268893 n/a 1268896 unspecified role unspecified role bait bait ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1268900 unspecified role unspecified role prey prey flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false S15a and S15b mcl1-bax 1268893 n/a 1268896 unspecified role unspecified role prey prey ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1268900 unspecified role unspecified role bait bait flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false S15a and S15b bcl2l11-bcl2-7 1268894 n/a 1268914 unspecified role unspecified role prey prey n/a 1268900 unspecified role unspecified role prey prey n/a 1268915 unspecified role unspecified role bait bait association association false false false 1c Treatment with ionomycin (induces cell death through Bim) increases the interaction.