IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ basak-2007-3 A fourth IkappaB protein within the NF-kappaB signaling module. mouse-embryonic_fibroblast Mus musculus embryonic fibroblasts embryonic_fibroblast Embryonic fibroblast Fibroblasts taken from an embryonic as opposed to a foetal or adult source. Foetus is defined as the stage at which tissue diferentiation is initiated. Tissue taken from an embryonic as opposed to a foetal or adult source. Embryo is defined as the development stage prior to organ formation. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Basak S., Kim H., Kearns JD., Tergaonkar V., O'Dea E., Werner SL., Benedict CA., Ware CF., Ghosh G., Verma IM., Hoffmann A. Apoptosis - Interactions involving proteins with a function related to apoptosis Cell (0092-8674) 2007 Only protein-protein interactions 8 imex curation basak-2007-1 A fourth IkappaB protein within the NF-kappaB signaling module. mouse-embryonic_fibroblast Mus musculus embryonic fibroblasts embryonic_fibroblast Embryonic fibroblast Fibroblasts taken from an embryonic as opposed to a foetal or adult source. Foetus is defined as the stage at which tissue diferentiation is initiated. Tissue taken from an embryonic as opposed to a foetal or adult source. Embryo is defined as the development stage prior to organ formation. emsa supershift electrophoretic mobility supershift assay emsa supershift antibody detection identification by antibody antibody detection Basak S., Kim H., Kearns JD., Tergaonkar V., O'Dea E., Werner SL., Benedict CA., Ware CF., Ghosh G., Verma IM., Hoffmann A. Apoptosis - Interactions involving proteins with a function related to apoptosis Cell (0092-8674) 2007 Only protein-protein interactions 8 imex curation basak-2007-2 A fourth IkappaB protein within the NF-kappaB signaling module. mouse-embryonic_fibroblast Mus musculus embryonic fibroblasts embryonic_fibroblast Embryonic fibroblast Fibroblasts taken from an embryonic as opposed to a foetal or adult source. Foetus is defined as the stage at which tissue diferentiation is initiated. Tissue taken from an embryonic as opposed to a foetal or adult source. Embryo is defined as the development stage prior to organ formation. tap tandem affinity purification TAP TAP tap mudpit multidimensional protein identification technology mudpit Basak S., Kim H., Kearns JD., Tergaonkar V., O'Dea E., Werner SL., Benedict CA., Ware CF., Ghosh G., Verma IM., Hoffmann A. Apoptosis - Interactions involving proteins with a function related to apoptosis Cell line (ikb-/-;rela-/-), TAP pulldown separated by gel electrophoresis followed by silver staining prior to protein identification by mass spectrometry Cell (0092-8674) 2007 Only protein-protein interactions 8 imex curation ikba_mouse NF-kappa-B inhibitor alpha I-kappa-B-alpha Nfkbia Ikba protein protein mouse Mus musculus Mouse MFQPAGHGQDWAMEGPRDGLKKERLVDDRHDSGLDSMKDEEYEQMVKELREIRLQPQEAPLAAEPWKQQLTEDGDSFLHLAIIHEEKPLTMEVIGQVKGDLAFLNFQNNLQQTPLHLAVITNQPGIAEALLKAGCDPELRDFRGNTPLHLACEQGCLASVAVLTQTCTPQHLHSVLQATNYNGHTCLHLASIHGYLAIVEHLVTLGADVNAQEPCNGRTALHLAVDLQNPDLVSLLLKCGADVNRVTYQGYSPYQLTWGRPSTRIQQQLGQLTLENLQMLPESEDEESYDTESEFTEDELPYDDCVFGGQRLTL p25799-pro_0000030313 Nuclear factor NF-kappa-B p50 subunit Nfkb1 DNA-binding factor KBF1 EBP-1 NF-kappa-B1 p84/NF-kappa-B1 p98 Nuclear factor of kappa light polypeptide gene enhancer in B-cells 1 protein protein mouse Mus musculus Mouse MADDDPYGTGQMFHLNTALTHSIFNAELYSPEIPLSTDGPYLQILEQPKQRGFRFRYVCEGPSHGGLPGASSEKNKKSYPQVKICNYVGPAKVIVQLVTNGKNIHLHAHSLVGKHCEDGVCTVTAGPKDMVVGFANLGILHVTKKKVFETLEARMTEACIRGYNPGLLVHSDLAYLQAEGGGDRQLTDREKEIIRQAAVQQTKEMDLSVVRLMFTAFLPDSTGSFTRRLEPVVSDAIYDSKAPNASNLKIVRMDRTAGCVTGGEEIYLLCDKVQKDDIQIRFYEEEENGGVWEGFGDFSPTDVHRQFAIVFKTPKYKDVNITKPASVFVQLRRKSDLETSEPKPFLYYPEIKDKEEVQRKRQKLMPNFSDSFGGGSGAGAGGGGMFGSGGGGGSTGSPGPGYGYSNYGFPPYGGITFHPGVTKSNAGVTHG 0597F8EA07635A94 1 431 tf65_mouse Transcription factor p65 Nuclear factor NF-kappa-B p65 subunit Rela Nfkb3 Nuclear factor of kappa light polypeptide gene enhancer in B-cells 3 protein protein mouse Mus musculus Mouse MDDLFPLIFPSEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPTIKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGYYEADLCPDRSIHSFQNLGIQCVKKRDLEQAISQRIQTNNNPFHVPIEEQRGDYDLNAVRLCFQVTVRDPAGRPLLLTPVLSHPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFSQADVHRQVAIVFRTPPYADPSLQAPVRVSMQLRRPSDRELSEPMEFQYLPDTDDRHRIEEKRKRTYETFKSIMKKSPFNGPTEPRPPTRRIAVPTRNSTSVPKPAPQPYTFPASLSTINFDEFSPMLLPSGQISNQALALAPSSAPVLAQTMVPSSAMVPLAQPPAPAPVLTPGPPQSLSAPVPKSTQAGEGTLSEALLHLQFDADEDLGALLGNSTDPGVFTDLASVDNSEFQQLLNQGVSMSHSTAEPMLMEYPEAITRLVTGSQRPPDPAPTPLGTSGLPNGLSGDEDFSSIADMDFSALLSQISS nfkb2_mouse Nuclear factor NF-kappa-B p100 subunit Nfkb2 DNA-binding factor KBF2 Nuclear factor of kappa light polypeptide gene enhancer in B-cells 2 protein protein mouse Mus musculus Mouse MDNCYDPGLDGIPEYDDFEFSPSIVEPKDPAPETADGPYLVIVEQPKQRGFRFRYGCEGPSHGGLPGASSEKGRKTYPTVKICNYEGPAKIEVDLVTHSDPPRAHAHSLVGKQCSELGVCAVSVGPKDMTAQFNNLGVLHVTKKNMMEIMIQKLQRQRLRSKPQGLTEAERRELEQEAKELKKVMDLSIVRLRFSAFLRASDGSFSLPLKPVISQPIHDSKSPGASNLKISRMDKTAGSVRGGDEVYLLCDKVQKDDIEVRFYEDDENGWQAFGDFSPTDVHKQYAIVFRTPPYHKMKIERPVTVFLQLKRKRGGDVSDSKQFTYYPLVEDKEEVQRKRRKALPTFSQPFGGGSHMGGGSGGSAGGYGGAGGGGSLGFFSSSLAYNPYQSGAAPMGCYPGGGGGAQMAGSRRDTDAGEGAEEPRTPPEAPQGEPQALDTLQRAREYNARLFGLAQRSARALLDYGVTADARALLAGQRHLLMAQDENGDTPLHLAIIHGQTGVIEQIAHVIYHAQYLGVINLTNHLHQTPLHLAVITGQTRVVSFLLQVGADPTLLDRHGDSALHLALRAGAAAPELLQALLRSGAHAVPQILHMPDFEGLYPVHLAVHARSPECLDLLVDCGAEVEAPERQGGRTALHLATEMEELGLVTHLVTKLHANVNARTFAGNTPLHLAAGLGSPTLTRLLLKAGADIHAENEEPLCPLPSPSTSGSDSDSEGPERDTQRNFRGHTPLDLTCSTKVKTLLLNAAQNTTEPPLAPPSPAGPGLSLGDAALQNLEQLLDGPEAQGSWAELAERLGLRSLVDTYRKTPSPSGSLLRSYKLAGGDLVGLLEALSDMGLHEGVRLLKGPETRDKLPSTEVKEDSAYGSQSVEQEAEKLCPPPEPPGGLCHGHPQPQVH p25799-pro_0000030312 Nuclear factor NF-kappa-B p105 subunit Nfkb1 DNA-binding factor KBF1 EBP-1 NF-kappa-B1 p84/NF-kappa-B1 p98 Nuclear factor of kappa light polypeptide gene enhancer in B-cells 1 protein protein mouse Mus musculus Mouse MADDDPYGTGQMFHLNTALTHSIFNAELYSPEIPLSTDGPYLQILEQPKQRGFRFRYVCEGPSHGGLPGASSEKNKKSYPQVKICNYVGPAKVIVQLVTNGKNIHLHAHSLVGKHCEDGVCTVTAGPKDMVVGFANLGILHVTKKKVFETLEARMTEACIRGYNPGLLVHSDLAYLQAEGGGDRQLTDREKEIIRQAAVQQTKEMDLSVVRLMFTAFLPDSTGSFTRRLEPVVSDAIYDSKAPNASNLKIVRMDRTAGCVTGGEEIYLLCDKVQKDDIQIRFYEEEENGGVWEGFGDFSPTDVHRQFAIVFKTPKYKDVNITKPASVFVQLRRKSDLETSEPKPFLYYPEIKDKEEVQRKRQKLMPNFSDSFGGGSGAGAGGGGMFGSGGGGGSTGSPGPGYGYSNYGFPPYGGITFHPGVTKSNAGVTHGTINTKFKNGPKDCAKSDDEESLTLPEKETEGEGPSLPMACTKTEPIALASTMEDKEQDMGFQDNLFLEKALQLARRHANALFDYAVTGDVKMLLAVQRHLTAVQDENGDSVLHLAIIHLHAQLVRDLLEVTSGLISDDIINMRNDLYQTPLHLAVITKQEDVVEDLLRVGADLSLLDRWGNSVLHLAAKEGHDRILSILLKSRKAAPLIDHPNGEGLNAIHIAVMSNSLPCLLLLVAAGAEVNAQEQKSGRTALHLAVEYDNISLAGCLLLEGDAHVDSTTYDGTTPLHIAAGRGSTRLAALLKAAGADPLVENFEPLYDLDDSWEKAGEDEGVVPGTTPLDMAANWQVFDILNGKPYEPVFTSDDILPQGDMKQLTEDTRLQLCKLLEIPDPDKNWATLAQKLGLGILNNAFRLSPAPSKTLMDNYEVSGGTIKELMEALQQMGYTEAIEVIQAAFRTPATTASSPVTTAQVHCLPLSSSSTRQHIDELRDSDSVCDSGVETSFRKLSFTESLTGDSPLLSLNKMPHGYGQEGPIEGKI 1 971 q9wtk5-pro_0000030 NF-kappaB2 p100 subunit - found in Q9WTK5 protein protein mouse Mus musculus Mouse An amino acid sequence which is not represented in UniProt relb_mouse Transcription factor RelB Relb protein protein mouse Mus musculus Mouse MPSRRAARESAPELGALGSSDLSSLSLTVSRTTDELEIIDEYIKENGFGLDGTQLSEMPRLVPRGPASLSSVTLGPAAPPPPATPSWSCTLGRLVSPGPCPRPYLVITEQPKQRGMRFRYECEGRSAGSILGESSTEASKTLPAIELRDCGGLREVEVTACLVWKDWPHRVHPHSLVGKDCTDGVCRVRLRPHVSPRHSFNNLGIQCVRKKEIEAAIERKIQLGIDPYNAGSLKNHQEVDMNVVRICFQASYRDQQGHLHRMDPILSEPVYDKKSTNTSELRICRINKESGPCTGGEELYLLCDKVQKEDISVVFSTASWEGRADFSQADVHRQIAIVFKTPPYEDLEISEPVTVNVFLQRLTDGVCSEPLPFTYLPRDHDSYGVDKKRKRGLPDVLGELSSSDPHGIESKRRKKKPVFLDHFLPGHSSGLFLPPSALQPADSDFFPASISLPGLEPPGGPDLLDDGFAYDPSAPTLFTMLDLLPPAPPLASAVVGSGGAGATVVESSGPEPLSLDSFAAPGPGDVGTASLVGSNMFPNQYREAAFGGGLLSPGPEAT q9wtk5-pro_0000030324 Nuclear factor NF-kappa-B p52 subunit Nuclear factor of kappa light polypeptide gene enhancer in B-cells 2 Nfkb2 DNA-binding factor KBF2 protein protein mouse Mus musculus Mouse MDNCYDPGLDGIPEYDDFEFSPSIVEPKDPAPETADGPYLVIVEQPKQRGFRFRYGCEGPSHGGLPGASSEKGRKTYPTVKICNYEGPAKIEVDLVTHSDPPRAHAHSLVGKQCSELGVCAVSVGPKDMTAQFNNLGVLHVTKKNMMEIMIQKLQRQRLRSKPQGLTEAERRELEQEAKELKKVMDLSIVRLRFSAFLRASDGSFSLPLKPVISQPIHDSKSPGASNLKISRMDKTAGSVRGGDEVYLLCDKVQKDDIEVRFYEDDENGWQAFGDFSPTDVHKQYAIVFRTPPYHKMKIERPVTVFLQLKRKRGGDVSDSKQFTYYPLVEDKEEVQRKRRKALPTFSQPFGGGSHMGGGSGGSAGGYGGAGGGGSLGFFSSSLAYNPYQSGAAPMGCYPGGGGGAQMAGSRRDTDAGEGAEEPRTPPEAPQGEPQALDTLQRAREYNARLFGLA 1 454 kappab_containing kappaB containing probe, RelA and RelB binding (PMID: 17254973) dna deoxyribonucleic acid DNA deoxyribonucleic acid dna DNA deoxyribonucleic acid in vitro In vitro rela-nfkb1-3 Interaction between NFKB1 p50 and RelA identified by coimmunoprecipitation 593494 N/A 593497 unspecified role unspecified role prey prey N/A 593498 unspecified role unspecified role prey prey N/A 593499 unspecified role unspecified role bait bait N/A 593500 unspecified role unspecified role prey prey N/A 593501 unspecified role unspecified role prey prey association association false false false 2C, 3D Experiments in Nfkbia deficient cells showed this protein to be inessential for complex formation The composition of this complex appears to alter in response to detergent-stripping of the p100 component following treatment of the cells with Lympotoxin beta receptor (fig 3D) rela-nfkb1-4 Interaction between p100, p105 and RelA identified by coimmunoprecipitation 593494 N/A 593502 unspecified role unspecified role prey prey N/A 593499 unspecified role unspecified role bait bait N/A 593501 unspecified role unspecified role prey prey association association false false false 2D relb-nfkb1-1 Interaction between p100 and RelB identified by coimmunoprecipitation 593494 N/A 593502 unspecified role unspecified role prey prey N/A 593503 unspecified role unspecified role bait bait N/A 593501 unspecified role unspecified role prey prey association association false false false 2D rela-nfkb1-5 Interaction between p100, p50 and RelA identified by coimmunoprecipitation 593494 N/A 593502 unspecified role unspecified role prey prey N/A 593498 unspecified role unspecified role prey prey N/A 593499 unspecified role unspecified role bait bait association association false false false 3A Anti-lymphotoxin-beta receptor nfkb1-nfkb2-1 Interaction between NFKB1 and p52 identified by coimmunoprecipitate 593494 N/A 593502 unspecified role unspecified role bait bait c-terminal region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false N/A 593504 unspecified role unspecified role prey prey physical association physical association false false false 3G Anti-lymphotoxin beta receptor Author stated length of Nfkb2 (934aa) is longer than that currently given in UniProt. rela-nfkb2-1 Interaction between p100 and RelA identified by coimmunoprecipitation 593494 N/A 593499 unspecified role unspecified role bait bait N/A 593502 unspecified role unspecified role prey prey physical association physical association false false false S2A Interaction shown not to depend on presence of I-kappaB alpha rela-nfkb1-6 Interaction between p105 and RelA identified by coimmunoprecipitation 593494 N/A 593499 unspecified role unspecified role bait bait N/A 593501 unspecified role unspecified role prey prey physical association physical association false false false S2B rela-nfkb1-1 Interaction between NFKB1 p50 and RelA identified by EMSA supershift 593495 N/A 593498 unspecified role unspecified role neutral component neutral component N/A 593499 unspecified role unspecified role neutral component neutral component N/A 593505 unspecified role unspecified role neutral component neutral component association association false false false 1C, 2G, S2C Anti-lymphotoxin beta receptor relb-nfkb2-2 Interaction between NFKB1 p52 and RelB identified by EMSA supershift 593495 N/A 593504 unspecified role unspecified role neutral component neutral component N/A 593503 unspecified role unspecified role neutral component neutral component N/A 593505 unspecified role unspecified role neutral component neutral component association association false false false 1C Anti-lymphotoxin beta receptor rela-nfkb1-2 Interaction between NFKB1 p50 and RelA identified by pulldown 593496 N/A 593498 unspecified role unspecified role prey prey N/A 593500 unspecified role unspecified role prey prey N/A 593499 unspecified role unspecified role bait bait region tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false 2B