IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ ihara_ohori-2007-1 Cell death suppressor Arabidopsis bax inhibitor-1 is associated with calmodulin binding and ion homeostasis. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast ub reconstruction ubiquitin reconstruction ub reconstruction predetermined predetermined participant predetermined Ihara-Ohori Y., Nagano M., Muto S., Uchimiya H., Kawai-Yamada M. Apoptosis - Interactions involving proteins with a function related to apoptosis mkawai@iam.u-tokyo.ac.jp Plant Physiol. (0032-0889) 2007 Only protein-protein interactions imex curation ihara_ohori-2007-2 Cell death suppressor Arabidopsis bax inhibitor-1 is associated with calmodulin binding and ion homeostasis. in vitro In vitro far western blotting far western blotting Affinity blotting Affinity blotting anti tag immunost anti tag immunostaining anti tag immunost Ihara-Ohori Y., Nagano M., Muto S., Uchimiya H., Kawai-Yamada M. Apoptosis - Interactions involving proteins with a function related to apoptosis mkawai@iam.u-tokyo.ac.jp Plant Physiol. (0032-0889) 2007 Only protein-protein interactions imex curation ihara_ohori-2007-3 Cell death suppressor Arabidopsis bax inhibitor-1 is associated with calmodulin binding and ion homeostasis. tobac-leaf Nicotiana tabacum (tobacco) leaf leaf leaf bifc bimolecular fluorescence complementation bifc predetermined predetermined participant predetermined Ihara-Ohori Y., Nagano M., Muto S., Uchimiya H., Kawai-Yamada M. Apoptosis - Interactions involving proteins with a function related to apoptosis BiFC was performed in 6-week-old Nicotiana benthamiana plants mkawai@iam.u-tokyo.ac.jp Plant Physiol. (0032-0889) 2007 Only protein-protein interactions imex curation calm_horvu Calmodulin CAM protein protein horvu Hordeum vulgare (Barley) Barley MADQLTDDQIAEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK bi1_arath Bax inhibitor 1 BI-1 K14A3.7 At5g47120 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MDAFSSFFDSQPGSRSWSYDSLKNFRQISPAVQNHLKRVYLTLCCALVASAFGAYLHVLWNIGGILTTIGCIGTMIWLLSCPPYEHQKRLSLLFVSAVLEGASVGPLIKVAIDVDPSILITAFVGTAIAFVCFSAAAMLARRREYLYLGGLLSSGLSMLMWLQFASSIFGGSASIFKFELYFGLLIFVGYMVVDTQEIIEKAHLGDMDYVKHSLTLFTDFVAVFVRILIIMLKNSADKEEKKKKRRN calm7_arath Calmodulin-7 CAM7 T28A8.100 At3g43810 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK bl_1-cam Arabidopsis Bax inhibitor 1 interacts with Hordeum Calmodulin protein CAM 728470 N/A 728473 unspecified role unspecified role prey prey region C-terminal ubiquitin tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 728474 unspecified role unspecified role bait bait c-terminal required to bind necessary binding region required to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region N-terminal ubiquitin tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Figure 1B bl_1-cam7 Bax inhibitor 1 interacts with Calmodulin 7 protein (CAM7) 728471 N/A 728475 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region S-tag: LysGluThrAlaAlaAlaLysPheGluArgGlnHisMetAspSer tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecobb Escherichia coli (strain B / BL21) N/A 728474 unspecified role unspecified role bait bait region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false c-terminal required to bind necessary binding region required to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction false false false Figure 2 The interaction only occurred in the presence of 1 mM Calcium Chloride as noted by the authors "EGTA inhibited such binding, confirming the importance of calcium in CaM-mediated binding." Ethylene glycol tetraacetic acid (EGTA) bl_1-cam7-1 Bax inhibitor 1 interacts with Calmodulin 7 protein (CAM7) 728472 N/A 728474 unspecified role unspecified role bait bait region NYFP N-terminal YFP tag yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecobb Escherichia coli (strain B / BL21) N/A 728475 unspecified role unspecified role prey prey region CYFP C-terminal yfp tag yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction false false false Figure 3E