UniProt UniProt http://www.uniprot.org nestler-2006-1 The zinc containing pro-apoptotic protein siva interacts with the peroxisomal membrane protein pmp22. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Nestler M., Martin U., Hortschansky P., Saluz HP., Henke A., Munder T. Apoptosis - Interactions involving proteins with a function related to apoptosis mnestler@fli-leibniz.de Mol. Cell. Biochem. (0300-8177) 2006 nestler-2006-3 The zinc containing pro-apoptotic protein siva interacts with the peroxisomal membrane protein pmp22. in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Nestler M., Martin U., Hortschansky P., Saluz HP., Henke A., Munder T. Apoptosis - Interactions involving proteins with a function related to apoptosis mnestler@fli-leibniz.de Mol. Cell. Biochem. (0300-8177) 2006 nestler-2006-2 The zinc containing pro-apoptotic protein siva interacts with the peroxisomal membrane protein pmp22. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Nestler M., Martin U., Hortschansky P., Saluz HP., Henke A., Munder T. Apoptosis - Interactions involving proteins with a function related to apoptosis mnestler@fli-leibniz.de human heart cDNA library Mol. Cell. Biochem. (0300-8177) 2006 siva_human Apoptosis regulatory protein Siva CD27-binding protein SIVA1 SIVA protein protein human Homo sapiens Human MPKRSCPFADVAPLQLKVRVSQRELSRGVCAERYSQEVFEKTKRLLFLGAQAYLDHVWDEGCAVVHLPESPKPGPTGAPRAARGQMLIGPDGRLIRSLGQASEADPSGVASIACSSCVRAVDGKAVCGQCERALCGQCVRTCWGCGSVACTLCGLVDCSDMYEKVLCTSCAMFET cd27_human CD27 antigen CD27L receptor T-cell activation antigen CD27 T14 Tumor necrosis factor receptor superfamily member 7 CD27 TNFRSF7 protein protein human Homo sapiens Human MARPHPWWLCVLGTLVGLSATPAPKSCPERHYWAQGKLCCQMCEPGTFLVKDCDQHRKAAQCDPCIPGVSFSPDHHTRPHCESCRHCNSGLLVRNCTITANAECACRNGWQCRDKECTECDPLPNPSLTARSSQALSPHPQPTHLPYVSEMLEARTAGHMQTLADFRQLPARTLSTHWPPQRSLCSSDFIRILVIFSGMFLVFTLAGALFLHQRRKYRSNKGESPVEPAEPCHYSCPREEEGSTIPIQEDYRKPEPACSP kapr_yeast cAMP-dependent protein kinase regulatory subunit YIL033C BCY1 REG1 SRA1 Bypass of cyclase mutations protein 1 Protein kinase A regulatory subunit protein protein yeast Saccharomyces cerevisiae Baker's yeast MVSSLPKESQAELQLFQNEINAANPSDFLQFSANYFNKRLEQQRAFLKAREPEFKAKNIVLFPEPEESFSRPQSAQSQSRSRSSVMFKSPFVNEDPHSNVFKSGFNLDPHEQDTHQQAQEEQQHTREKTSTPPLPMHFNAQRRTSVSGETLQPNNFDDWTPDHYKEKSEQQLQRLEKSIRNNFLFNKLDSDSKRLVINCLEEKSVPKGATIIKQGDQGDYFYVVEKGTVDFYVNDNKVNSSGPGSSFGELALMYNSPRAATVVATSDCLLWALDRLTFRKILLGSSFKKRLMYDDLLKSMPVLKSLTTYDRAKLADALDTKIYQPGETIIREGDQGENFYLIEYGAVDVSKKGQGVINKLKDHDYFGEVALLNDLPRQATVTATKRTKVATLGKSGFQRLLGPAVDVLKLNDPTRH 6D7D97D8E4340AF3 pxmp2_human Peroxisomal membrane protein 2 PXMP2 PMP22 22 kDa peroxisomal membrane protein protein protein human Homo sapiens Human MAPAASRLRAEAGLGALPRRALAQYLLFLRLYPVLTKAATSGILSALGNFLAQMIEKKRKKENSRSLDVGGPLRYAVYGFFFTGPLSHFFYFFMEHWIPPEVPLAGLRRLLLDRLVFAPAFLMLFFLIMNFLEGKDASAFAAKMRGGFWPALRMNWRVWTPLQFININYVPLKFRVLFANLAALFWYAYLASLGK cd27-siva1-1 664989 N/A 664992 unspecified role unspecified role prey prey region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 664993 unspecified role unspecified role bait bait region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false 2B and 2C SIVA1 fragment 1-64 and isoform siva-2 (O15304-2) showed low interactions only. Co-expression of oxsackievirus B3 capsid protein VP2 abolished the interaction. bcy1-bcy1-1 664989 N/A 664994 unspecified role unspecified role bait bait N/A 664994 unspecified role unspecified role prey prey physical association physical association false false false 2B siva1-pxmp2-2 664990 N/A 664995 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. N/A 664992 unspecified role unspecified role bait bait region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) physical association physical association false false false 3B siva1-pxmp2-3 664990 N/A 664995 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. N/A 664992 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) physical association physical association false false false 3B siva1-pxmp2-1 664991 N/A 664995 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 664992 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false 3A