IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ brandt-2006-1 On-bead chemical synthesis and display of phosphopeptides for affinity pull-down proteomics. in vitro In vitro affinity chrom affinity chromatography technology Affinity purification Affinity purification affinity chrom ms participant Identification by mass spectrometry ms participant Brandt M., Madsen JC., Bunkenborg J., Jensen ON., Gammeltoft S., Jensen KJ. Apoptosis - Interactions involving proteins with a function related to apoptosis Affinity pull down of 14-3-3 proteins carried out on PEGA beads. figure 5, table 2 kjj@kvl.dk Chembiochem (1439-4227) 2006 1433g_chlae_protein 14-3-3 protein gamma protein protein chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey An amino acid sequence which is not represented in UniProt Similar to P61982 1433z_cerae_protein 14-3-3 protein zeta/delta protein protein chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey An amino acid sequence which is not represented in UniProt 1433b_chlae_protein 14-3-3 protein beta/alpha protein protein chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey An amino acid sequence which is not represented in UniProt 1433f_cerae_protein 14-3-3 protein eta protein protein chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey Similar to Q04917 An amino acid sequence which is not represented in UniProt 1433s_chlae_protein 14-3-3 protein sigma protein protein chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey Similar to P31947 An amino acid sequence which is not represented in UniProt 1433t_cerae_protein 14-3-3 theta protein protein chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey Similar to P27348 An amino acid sequence which is not represented in UniProt 14-3-3 epsilon 14-3-3 epsilon protein protein chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey Similar to P62258 An amino acid sequence which is not represented in UniProt bad_mouse Bcl2-associated agonist of cell death Bad Bbc6 Bcl-2-binding component 6 Bcl-xL/Bcl-2-associated death promoter Bcl2 antagonist of cell death protein protein mouse Mus musculus Mouse MGTPKQPSLAPAHALGLRKSDPGIRSLGSDAGGRRWRPAAQSMFQIPEFEPSEQEDASATDRGLGPSLTEDQPGPYLAPGLLGSNIHQQGRAATNSHHGGAGAMETRSRHSSYPAGTEEDEGMEEELSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFEGSFKGLPRPKSAGTATQMRQSAGWTRIIQSWWDRNLGKGGSTPSQ bad-14-3-3 338727 n/a 338728 unspecified role unspecified role prey prey n/a 338729 unspecified role unspecified role prey prey N/A 338730 unspecified role unspecified role prey prey N/A 338731 unspecified role unspecified role prey prey N/A 338732 unspecified role unspecified role prey prey N/A 338733 unspecified role unspecified role prey prey N/A 338734 unspecified role unspecified role prey prey N/A 338735 unspecified role unspecified role bait bait region synthetic phosphopeptide with linker of 3 amino acids (AGA) sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region phosphorylation required for binding opser O-phospho-L-serine (2S)-2-amino-3-(phosphonooxy)propanoic acid 2-amino-3-hydroxypropanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)propanoic acid ACT_SITE Phosphoserine intermediate MOD_RES Phosphoserine O-phospho-L-serine O-phosphonoserine O-phosphorylated L-serine O3-phosphoserine serine phosphate ester OPSer Phospho Phospho Seryl Phosphorylation phosphorylations certain certain sequence position certain certain certain sequence position certain false region synthetic phosphopeptide sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region phosphorylation required for binding opser O-phospho-L-serine (2S)-2-amino-3-(phosphonooxy)propanoic acid 2-amino-3-hydroxypropanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)propanoic acid ACT_SITE Phosphoserine intermediate MOD_RES Phosphoserine O-phospho-L-serine O-phosphonoserine O-phosphorylated L-serine O3-phosphoserine serine phosphate ester OPSer Phospho Phospho Seryl Phosphorylation phosphorylations certain certain sequence position certain certain certain sequence position certain false chemical synthesis Chemical synthesis (Chemical synthesis) association association false false false