IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ li-2006-4 The SRC-3/AIB1 coactivator is degraded in a ubiquitin- and ATP-independent manner by the REGgamma proteasome. in vitro In vitro pull down pull down predetermined predetermined participant predetermined Li X., Lonard DM., Jung SY., Malovannaya A., Feng Q., Qin J., Tsai SY., Tsai MJ., O'Malley BW. Apoptosis - Interactions involving proteins with a function related to apoptosis 1D and E 1D berto@bcm.tmc.edu Cell (0092-8674) 2006 1291..1291 1291..1301 2006-07-10: Only interaction involving solely Proteins were exported. Only protein-protein interactions 5 imex curation li-2006-1 The SRC-3/AIB1 coactivator is degraded in a ubiquitin- and ATP-independent manner by the REGgamma proteasome. human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti bait coip anti bait coimmunoprecipitation anti bait coip ms participant Identification by mass spectrometry ms participant Li X., Lonard DM., Jung SY., Malovannaya A., Feng Q., Qin J., Tsai SY., Tsai MJ., O'Malley BW. Apoptosis - Interactions involving proteins with a function related to apoptosis Nuclear extracts from Hela cells used. 1A berto@bcm.tmc.edu Anti SRC-3 antibody used. Cell (0092-8674) 2006 1291..1291 1291..1301 2006-07-10: Only interaction involving solely Proteins were exported. Only protein-protein interactions 5 imex curation li-2006-2 The SRC-3/AIB1 coactivator is degraded in a ubiquitin- and ATP-independent manner by the REGgamma proteasome. human-mcf7 Homo sapiens mammary carcinoma cells mcf7 mammary carcinoma cells anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Li X., Lonard DM., Jung SY., Malovannaya A., Feng Q., Qin J., Tsai SY., Tsai MJ., O'Malley BW. Apoptosis - Interactions involving proteins with a function related to apoptosis Cell lysates used. 1B berto@bcm.tmc.edu Anti SRC-3 antibody used. Cell (0092-8674) 2006 1291..1291 1291..1301 2006-07-10: Only interaction involving solely Proteins were exported. Only protein-protein interactions 5 imex curation li-2006-3 The SRC-3/AIB1 coactivator is degraded in a ubiquitin- and ATP-independent manner by the REGgamma proteasome. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Li X., Lonard DM., Jung SY., Malovannaya A., Feng Q., Qin J., Tsai SY., Tsai MJ., O'Malley BW. Apoptosis - Interactions involving proteins with a function related to apoptosis 1C berto@bcm.tmc.edu Cell (0092-8674) 2006 1291..1291 1291..1301 2006-07-10: Only interaction involving solely Proteins were exported. Only protein-protein interactions 5 imex curation psme3_human Proteasome activator complex subunit 3 PSME3 Proteasome activator 28 subunit gamma Activator of multicatalytic protease subunit 3 11S regulator complex subunit gamma Ki nuclear autoantigen protein protein human Homo sapiens Human MASLLKVDQEVKLKVDSFRERITSEAEDLVANFFPKKLLELDSFLKEPILNIHDLTQIHSDMNLPVPDPILLTNSHDGLDGPTYKKRRLDECEEAFQGTKVFVMPNGMLKSNQQLVDIIEKVKPEIRLLIEKCNTVKMWVQLLIPRIEDGNNFGVSIQEETVAELRTVESEAASYLDQISRYYITRAKLVSKIAKYPHVEDYRRTVTEIDEKEYISLRLIISELRNQYVTLHDMILKNIEKIKRPRSSNAETLY ncoa3_human Nuclear receptor coactivator 3 NCOA3 AIB1 RAC3 Thyroid hormone receptor activator molecule 1 Receptor-associated coactivator 3 BHLHE42 Steroid receptor coactivator protein 3 CBP-interacting protein Amplified in breast cancer 1 protein ACTR Class E basic helix-loop-helix protein 42 TRAM1 protein protein human Homo sapiens Human MSGLGENLDPLASDSRKRKLPCDTPGQGLTCSGEKRRREQESKYIEELAELISANLSDIDNFNVKPDKCAILKETVRQIRQIKEQGKTISNDDDVQKADVSSTGQGVIDKDSLGPLLLQALDGFLFVVNRDGNIVFVSENVTQYLQYKQEDLVNTSVYNILHEEDRKDFLKNLPKSTVNGVSWTNETQRQKSHTFNCRMLMKTPHDILEDINASPEMRQRYETMQCFALSQPRAMMEEGEDLQSCMICVARRITTGERTFPSNPESFITRHDLSGKVVNIDTNSLRSSMRPGFEDIIRRCIQRFFSLNDGQSWSQKRHYQEAYLNGHAETPVYRFSLADGTIVTAQTKSKLFRNPVTNDRHGFVSTHFLQREQNGYRPNPNPVGQGIRPPMAGCNSSVGGMSMSPNQGLQMPSSRAYGLADPSTTGQMSGARYGGSSNIASLTPGPGMQSPSSYQNNNYGLNMSSPPHGSPGLAPNQQNIMISPRNRGSPKIASHQFSPVAGVHSPMASSGNTGNHSFSSSSLSALQAISEGVGTSLLSTLSSPGPKLDNSPNMNITQPSKVSNQDSKSPLGFYCDQNPVESSMCQSNSRDHLSDKESKESSVEGAENQRGPLESKGHKKLLQLLTCSSDDRGHSSLTNSPLDSSCKESSVSVTSPSGVSSSTSGGVSSTSNMHGSLLQEKHRILHKLLQNGNSPAEVAKITAEATGKDTSSITSCGDGNVVKQEQLSPKKKENNALLRYLLDRDDPSDALSKELQPQVEGVDNKMSQCTSSTIPSSSQEKDPKIKTETSEEGSGDLDNLDAILGDLTSSDFYNNSISSNGSHLGTKQQVFQGTNSLGLKSSQSVQSIRPPYNRAVSLDSPVSVGSSPPVKNISAFPMLPKQPMLGGNPRMMDSQENYGSSMGGPNRNVTVTQTPSSGDWGLPNSKAGRMEPMNSNSMGRPGGDYNTSLPRPALGGSIPTLPLRSNSIPGARPVLQQQQQMLQMRPGEIPMGMGANPYGQAAASNQLGSWPDGMLSMEQVSHGTQNRPLLRNSLDDLVGPPSNLEGQSDERALLDQLHTLLSNTDATGLEEIDRALGIPELVNQGQALEPKQDAFQGQEAAVMMDQKAGLYGQTYPAQGPPMQGGFHLQGQSPSFNSMMNQMNQQGNFPLQGMHPRANIMRPRTNTPKQLRMQLQQRLQGQQFLNQSRQALELKMENPTAGGAAVMRPMMQPQVSSQQGFLNAQMVAQRSRELLSHHFRQQRVAMMMQQQQQQQQQQQQQQQQQQQQQQQQQQQQQTQAFSPPPNVTASPSMDGLLAGPTMPQAPPQQFPYQPNYGMGQQPDPAFGRVSSPPNAMMSSRMGPSQNPMMQHPQAASIYQSSEMKGWPSGNLARNSSFSQQQFAHQGNPAVYSMVHMNGSSGHMGQMNMNPMPMSGMPMGPDQKYC ncoa3-psme3-3 Interaction detected by GST-pulldown. 328717 N/A 328721 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro N/A 328722 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false hat domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false ncoa3-psme3-4 Interaction detected by GST pull down. 328717 N/A 328721 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 328722 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false hat domain binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false in vitro In vitro direct interaction direct interaction false false false ncoa3-psme3 Interaction detected by CoIP. 328718 N/A 328721 unspecified role unspecified role prey prey N/A 328722 unspecified role unspecified role bait bait physical association physical association false false false ncoa3-psme3-1 Interaction detected by CoIP. 328719 N/A 328721 unspecified role unspecified role prey prey N/A 328722 unspecified role unspecified role bait bait physical association physical association false false false ncoa3-psme3-2 Interaction detected by CoIP. 328720 N/A 328721 unspecified role unspecified role prey prey N/A 328722 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Q9Y6Q9 transient transfection Q6UW15 endogenous