IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ zhu-2005-1 Apoptosis induced by a new member of saponin family is mediated through caspase-8-dependent cleavage of Bcl-2. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Zhu J., Xiong L., Yu B., Wu J. Apoptosis - Interactions involving proteins with a function related to apoptosis The range for the p10 subunit of caspase-8 was taken from the UniProtKB entry for this protein. The cysteine in the active site of the large (p18) subunit was also identified from the UniProtKB entry. wujr@sibs.ac.cn Mol. Pharmacol. (0026-895X) 2005 Only protein-protein interactions imex curation Cancer - Interactions investigated in the context of cancer zhu-2005-2 Apoptosis induced by a new member of saponin family is mediated through caspase-8-dependent cleavage of Bcl-2. crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Zhu J., Xiong L., Yu B., Wu J. Apoptosis - Interactions involving proteins with a function related to apoptosis wujr@sibs.ac.cn Mol. Pharmacol. (0026-895X) 2005 Only protein-protein interactions imex curation Cancer - Interactions investigated in the context of cancer The range for the p10 subunit of caspase-8 was taken from the UniProtKB entry for this protein. The cysteine in the active site of the large (p18) subunit was also identified from the UniProtKB entry. bcl2_human Apoptosis regulator Bcl-2 BCL2 protein protein human Homo sapiens Human MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPAASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK casp8_human Caspase-8 CASP8 MCH5 ICE-like apoptotic protease 5 MORT1-associated ced-3 homolog FADD-homologous ICE/ced-3-like protease FADD-like ICE Apoptotic cysteine protease Apoptotic protease Mch-5 CAP4 protein protein human Homo sapiens Human MDFSRNLYDIGEQLDSEDLASLKFLSLDYIPQRKQEPIKDALMLFQRLQEKRMLEESNLSFLKELLFRINRLDLLITYLNTRKEEMERELQTPGRAQISAYRVMLYQISEEVSRSELRSFKFLLQEEISKCKLDDDMNLLDIFIEMEKRVILGEGKLDILKRVCAQINKSLLKIINDYEEFSKERSSSLEGSPDEFSNGEELCGVMTISDSPREQDSESQTLDKVYQMKSKPRGYCLIINNHNFAKAREKVPKLHSIRDRNGTHLDAGALTTTFEELHFEIKPHDDCTVEQIYEILKIYQLMDHSNMDCFICCILSHGDKGIIYGTDGQEAPIYELTSQFTGLKCPSLAGKPKVFFIQACQGDNYQKGIPVETDSEEQPYLEMDLSSPQTRYIPDEADFLLGMATVNNCVSYRNPAEGTWYIQSLCQSLRERCPRGDDILTILTEVNYEVSNKDDKKNMGKQMPQPTFTLRKKLVFPSD bcl2_crigr Apoptosis regulator Bcl-2 BCL2 protein protein crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster MAQAGRTGYDNREIVMKYIHYKLSQRGYEWDVGDVDAAPLGAAPTPGIFSFQPESNPTPAVHRDMAARTSPLRPIVATTGPTLSPVPPVVHLTLRRAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSVRPLFDFSWLSLKTLLSLALVGACITLGTYLGHK casp8-bcl2 Caspase-8 and Bcl-2 interact in a yeast two-hybrid assay 730502 N/A 730504 unspecified role unspecified role prey prey N/A 730505 unspecified role unspecified role bait bait c-terminal p10 small subunit sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis range range range range false Q14790:p.Cys360Ser mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false 6 A The range for the p10 subunit of caspase-8 was taken from the UniProtKB entry for this protein, as this information was not given by the authors. bcl2-casp8 Caspase-8 coimmunoprecipitates with endogenous Bcl-2 in CHO lysates 730503 N/A 730505 unspecified role unspecified role prey prey c-terminal p10 small subunit sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 730506 unspecified role unspecified role bait bait physical association physical association false false false 6 B