IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ willis-2005-2 Proapoptotic Bak is sequestered by Mcl-1 and Bcl-xL, but not Bcl-2, until displaced by BH3-only proteins. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Willis SN., Chen L., Dewson G., Wei A., Naik E., Fletcher JI., Adams JM., Huang DC. Apoptosis - Interactions involving proteins with a function related to apoptosis Binding of protein 1 to the competitor peptide protein 2 competes with its binding to immobilized peptide ligand. Strength of interaction between protein 1 and protein 2 is given by a measure (IC50) of the inhibition of the interaction between protein 1 and immobilized peptide. 3A and 4A huang_d@wehi.edu.au Genes Dev. (0890-9369) 2005 willis-2005-1 Proapoptotic Bak is sequestered by Mcl-1 and Bcl-xL, but not Bcl-2, until displaced by BH3-only proteins. in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Willis SN., Chen L., Dewson G., Wei A., Naik E., Fletcher JI., Adams JM., Huang DC. Apoptosis - Interactions involving proteins with a function related to apoptosis Binding of protein 1 to the competitor peptide protein 2 competes with its binding to immobilized peptide ligand. Strength of interaction between protein 1 and protein 2 is given by a measure (IC50) of the inhibition of the interaction between protein 1 and immobilized peptide. 3A and 4A huang_d@wehi.edu.au Genes Dev. (0890-9369) 2005 willis-2005-3 Proapoptotic Bak is sequestered by Mcl-1 and Bcl-xL, but not Bcl-2, until displaced by BH3-only proteins. human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Willis SN., Chen L., Dewson G., Wei A., Naik E., Fletcher JI., Adams JM., Huang DC. Apoptosis - Interactions involving proteins with a function related to apoptosis Binding of protein 1 to the competitor peptide protein 2 competes with its binding to immobilized peptide ligand. Strength of interaction between protein 1 and protein 2 is given by a measure (IC50) of the inhibition of the interaction between protein 1 and immobilized peptide. 3A and 4A huang_d@wehi.edu.au Genes Dev. (0890-9369) 2005 willis-2005-4 Proapoptotic Bak is sequestered by Mcl-1 and Bcl-xL, but not Bcl-2, until displaced by BH3-only proteins. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Willis SN., Chen L., Dewson G., Wei A., Naik E., Fletcher JI., Adams JM., Huang DC. Apoptosis - Interactions involving proteins with a function related to apoptosis Binding of protein 1 to the competitor peptide protein 2 competes with its binding to immobilized peptide ligand. Strength of interaction between protein 1 and protein 2 is given by a measure (IC50) of the inhibition of the interaction between protein 1 and immobilized peptide. 3A and 4A huang_d@wehi.edu.au Genes Dev. (0890-9369) 2005 bak_human Bcl-2 homologous antagonist/killer Apoptosis regulator BAK Bcl-2-like protein 7 BAK1 BAK BCL2L7 CDN1 protein protein human Homo sapiens Human MASGQGPGPPRQECGEPALPSASEEQVAQDTEEVFRSYVFYRHQQEQEAEGVAAPADPEMVTLPLQPSSTMGQVGRQLAIIGDDINRRYDSEFQTMLQHLQPTAENAYEYFTKIATSLFESGINWGRVVALLGFGYRLALHVYQHGLTGFLGQVTRFVVDFMLHHCIARWIAQRGGWVAALNLGNGPILNVLVVLGVVLLGQFVVRRFFKS mcl1_mouse Induced myeloid leukemia cell differentiation protein Mcl-1 homolog Bcl-2-related protein EAT/mcl1 Mcl1 protein protein mouse Mus musculus Mouse MFGLRRNAVIGLNLYCGGASLGAGGGSPAGARLVAEEAKARREGGGEAALLPGARVVARPPPVGAEDPDVTASAERRLHKSPGLLAVPPEEMAASAAAAIVSPEEELDGCEPEAIGKRPAVLPLLERVSEAAKSSGADGSLPSTPPPPEEEEDDLYRQSLEIISRYLREQATGSKDSKPLGEAGAAGRRALETLRRVGDGVQRNHETAFQGMLRKLDIKNEGDVKSFSRVMVHVFKDGVTNWGRIVTLISFGAFVAKHLKSVNQESFIEPLAETITDVLVRTKRDWLVKQRGWDGFVEFFHVQDLEGGIRNVLLAFAGVAGVGAGLAYLIR q07817-1 Bcl-2-like protein 1 BCLX Apoptosis regulator Bcl-X BCL2L1 BCL2L Bcl-xL protein protein human Homo sapiens Human MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLADSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK mcl1_human Induced myeloid leukemia cell differentiation protein Mcl-1 Bcl-2-related protein EAT/mcl1 mcl1/EAT MCL1 BCL2L3 Bcl-2-like protein 3 protein protein human Homo sapiens Human MFGLKRNAVIGLNLYCGGAGLGAGSGGATRPGGRLLATEKEASARREIGGGEAGAVIGGSAGASPPSTLTPDSRRVARPPPIGAEVPDVTATPARLLFFAPTRRAAPLEEMEAPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGESGNNTSTDGSLPSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVRTKRDWLVKQRGWDGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR bax_human Apoptosis regulator BAX BAX BCL2L4 Bcl-2-like protein 4 protein protein human Homo sapiens Human MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGTPTWQTVTIFVAGVLTASLTIWKKMG apr_human Phorbol-12-myristate-13-acetate-induced protein 1 NOXA Immediate-early-response protein APR PMAIP1 Protein Noxa protein protein human Homo sapiens Human MPGKKARKNAQPSPARAPAELEVECATQLRRFGDKLNFRQKLLNLISKLFCSGT bak-mcl1-2 Interaction of human BAK and murine Mcl-1 identified by coimmunoprecipitation 234889 N/A 234893 unspecified role unspecified role prey prey in vitro In vitro N/A 234894 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false bak-bclxl-3 Interaction of BCL-Xl and BAK identified by coimmunoprecipitation 234889 N/A 234893 unspecified role unspecified role prey prey in vitro In vitro N/A 234895 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false bak-mcl1-4 Interaction of BAK and Mcl-1 identified by coimmunoprecipitation 234889 N/A 234893 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Q16611:p.Leu78Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 234896 unspecified role unspecified role prey prey physical association physical association false false false bak-bax-1 Interaction of BAK and BAX identified by coimmunoprecipitation 234889 N/A 234893 unspecified role unspecified role bait bait Q16611:p.Leu78Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro N/A 234897 unspecified role unspecified role prey prey physical association physical association false false false bak-1 Homodimerisation of human BAK identified by coimmunoprecipitation 234889 N/A 234893 unspecified role unspecified role prey prey N/A 234893 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Q16611:p.Leu78Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false pmaip1-mcl1-1 Interaction of PMAIP1 (NOXA) and Mcl-1 identified by coimmunoprecipitation 234889 N/A 234898 unspecified role unspecified role bait bait n-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Q13794:p.Leu36Glu mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false Q13794:p.Phe32Glu mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false Q13794:p.Leu29Glu mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false N/A 234896 unspecified role unspecified role prey prey physical association physical association false false false Appears to bind to MCL1 in competition with BAK bak-mcl1-1 Interaction of human BAK and murine Mcl-1 identified by biacore 234890 N/A 234894 unspecified role unspecified role prey prey N/A 234893 unspecified role unspecified role bait bait region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false Q16611:p.Leu78Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false in vitro In vitro direct interaction direct interaction false false false IC50=8nM bak-bclxl-2 Interaction of human BCL-Xl and BAK identified by biacore 234890 N/A 234893 unspecified role unspecified role bait bait region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false Q16611:p.Leu78Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 234895 unspecified role unspecified role prey prey direct interaction direct interaction false false false IC50=50nM bak-mcl1-3 Interaction of BAK and Mcl-1 identified by coimmunoprecipitation 234891 N/A 234893 unspecified role unspecified role prey prey N/A 234896 unspecified role unspecified role bait bait physical association physical association false false false bak-bclxl-4 Interaction of human BCL-Xl and BAK identified by coimmunoprecipitation 234891 N/A 234895 unspecified role unspecified role bait bait N/A 234893 unspecified role unspecified role prey prey in vitro In vitro direct interaction direct interaction false false false bak-mcl1-5 Interaction of human BAK and murine Mcl-1 identified by GST pulldown 234892 N/A 234893 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro N/A 234894 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false By PMAIP1 (Q13794) - a BH3 domain peptide compete for binding to MCL-1 with BAK