IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ saras-2004-2 Wrch1 is a GTPase-deficient Cdc42-like protein with unusual binding characteristics and cellular effects. chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Saras J., Wollberg P., Aspenstrom P. Apoptosis - Interactions involving proteins with a function related to apoptosis RHOU was loaded with radio-labelled GTP and an exchange rate measured by addition of excess cold GTP Experiment repeated using CDC42 as bait but the source of CDC42 could not be determined. pontus.aspenstrom@licr.uu.se Exp. Cell Res. (0014-4827) 2004 Only protein-protein interactions imex curation saras-2004-1 Wrch1 is a GTPase-deficient Cdc42-like protein with unusual binding characteristics and cellular effects. in vitro In vitro filter binding filter binding Filter overlay assay Filter overlay assay predetermined predetermined participant predetermined Saras J., Wollberg P., Aspenstrom P. Apoptosis - Interactions involving proteins with a function related to apoptosis RHOU was loaded with radio-labelled GTP and an exchange rate measured by addition of excess cold GTP Experiment repeated using CDC42 as bait but the source of CDC42 could not be determined. pontus.aspenstrom@licr.uu.se Exp. Cell Res. (0014-4827) 2004 Only protein-protein interactions imex curation saras-2004-3 Wrch1 is a GTPase-deficient Cdc42-like protein with unusual binding characteristics and cellular effects. chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 pull down pull down anti tag western anti tag western blot anti tag western Saras J., Wollberg P., Aspenstrom P. Apoptosis - Interactions involving proteins with a function related to apoptosis RHOU was loaded with radio-labelled GTP and an exchange rate measured by addition of excess cold GTP Experiment repeated using CDC42 as bait but the source of CDC42 could not be determined. pontus.aspenstrom@licr.uu.se Exp. Cell Res. (0014-4827) 2004 Only protein-protein interactions imex curation saras-2004-4 Wrch1 is a GTPase-deficient Cdc42-like protein with unusual binding characteristics and cellular effects. mouse-nih_3t3 Mus musculus Swiss NIH 3t3 embryo fibroblast cells nih_3t3 Mouse Swiss NIH embryo contact inhibited fibroblast cells confocal microscopy confocal microscopy anti tag immunost anti tag immunostaining anti tag immunost Saras J., Wollberg P., Aspenstrom P. Apoptosis - Interactions involving proteins with a function related to apoptosis RHOU was loaded with radio-labelled GTP and an exchange rate measured by addition of excess cold GTP Experiment repeated using CDC42 as bait but the source of CDC42 could not be determined. pontus.aspenstrom@licr.uu.se Exp. Cell Res. (0014-4827) 2004 Only protein-protein interactions imex curation rhou_human Rho-related GTP-binding protein RhoU RHOU ARHU CDC42L1 G28K WRCH1 SB128 Wnt-1 responsive Cdc42 homolog 1 Ryu GTPase CDC42-like GTPase 1 Rho GTPase-like protein ARHU GTP-binding protein-like 1 protein protein human Homo sapiens Human MPPQQGDPAFPDRCEAPPVPPRRERGGRGGRGPGEPGGRGRAGGAEGRGVKCVLVGDGAVGKTSLVVSYTTNGYPTEYIPTAFDNFSAVVSVDGRPVRLQLCDTAGQDEFDKLRPLCYTNTDIFLLCFSVVSPSSFQNVSEKWVPEIRCHCPKAPIILVGTQSDLREDVKVLIELDKCKEKPVPEEAAKLCAEEIKAASYIECSALTQKNLKEVFDAAIVAGIQYSDTQQQPKKSKSRTPDKMKNLSKSWWKKYCCFV q13153-2 Serine/threonine-protein kinase PAK 1 PAK1B PAK1 Alpha-PAK p21-activated kinase 1 p65-PAK protein protein human Homo sapiens Human MSNNGLDIQDKPPAPPMRNTSTMIGAGSKDAGTLNHGSKPLPPNPEEKKKKDRFYRSILPGDKTNKKKEKERPEISLPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKSEQKKNPQAVLDVLEFYNSKKTSNSQKYMSFTDKSAEDYNSSNALNVKAVSETPAVPPVSEDEDDDDDDATPPPVIAPRPEHTKSVYTRSVIEPLPVTPTRDVATSPISPTENNTTPPDALTRNTEKQKKKPKMSDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTAMDVATGQEVAIKQMNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETCMDEGQIAAVCRECLQALEFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMIEGEPPYLNENPLRALYLIATNGTPELQNPEKLSAIFRDFLNRCLEMDVEKRGSAKELLQVRKLRFQVFSNFSMIAASIPEDCQAPLQPHSTDCCS nck2_human Cytoplasmic protein NCK2 NCK adaptor protein 2 SH2/SH3 adaptor protein NCK-beta NCK2 GRB4 Growth factor receptor-bound protein 4 protein protein human Homo sapiens Human MTEEVIVIAKWDYTAQQDQELDIKKNERLWLLDDSKTWWRVRNAANRTGYVPSNYVERKNSLKKGSLVKNLKDTLGLGKTRRKTSARDASPTPSTDAEYPANGSGADRIYDLNIPAFVKFAYVAEREDELSLVKGSRVTVMEKCSDGWWRGSYNGQIGWFPSNYVLEEVDEAAAESPSFLSLRKGASLSNGQGSRVLHVVQTLYPFSSVTEEELNFEKGETMEVIEKPENDPEWWKCKNARGQVGLVPKNYVVVLSDGPALHPAHAPQISYTGPSSSGRFAGREWYYGNVTRHQAECALNERGVEGDFLIRDSESSPSDFSVSLKASGKNKHFKVQLVDNVYCIGQRRFHTMDELVEHYKKAPIFTSEHGEKLYLVRALQ gtp guanosine triphosphate - GTP 5'-GTP GTP Guanosine 5'-triphosphate guanosine 5'-triphosphoric acid guanosine triphosphate GUANOSINE-5'-TRIPHOSPHATE H4gtp guanosine 5'-(tetrahydrogen triphosphate) small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) InChI=1/C10H16N5O14P3/c11-10-13-7-4(8(18)14-10)12-2-15(7)9-6(17)5(16)3(27-9)1-26-31(22,23)29-32(24,25)28-30(19,20)21/h2-3,5-6,9,16-17H,1H2,(H,22,23)(H,24,25)(H2,19,20,21)(H3,11,13,14,18)/t3-,5-,6-,9-/m1/s1/f/h14,19-20,22,24H,11H2 pak1-rhou-1 Interaction between PAK1 and RHOU demonstrated by coimmunoprecipitation 725677 N/A 725681 unspecified role unspecified role bait bait Q7L0Q8:p.Thr63Asn mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false N/A 725682 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 8 Q7L0Q8 transfection; Q13153-2 transfection nck2-rhou-1 Interaction between NCK2 and RHOU demonstrated by coimmunoprecipitation 725677 N/A 725683 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 725681 unspecified role unspecified role bait bait region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Fig. 8 Q7L0Q8; O43639 transfection rhou-gtp-1 Binding of GTP to RHOU (Wrch1) 725678 N/A 725684 unspecified role unspecified role prey prey N/A 725681 unspecified role unspecified role bait bait ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false RhoU produced as a GST molecule, tag subsequently removed by thrombin cleavage. GTP is [3H]-labelled RhoU was shown to undergo a high rate of GTP exchange but had no intrinsic GTPase activity. Fig. 7 nck2-rhou-2 Interaction between NCK2 and RHOU demonstrated by pulldown 725679 N/A 725683 unspecified role unspecified role bait bait sh3 domain sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis range range range range false sh3 domain sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis range range range range false region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 725681 unspecified role unspecified role prey prey region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 physical association physical association false false false Fig. 10 nck2-rhou-3 Interaction between NCK2 and RHOU demonstrated by colocalisation 725680 N/A 725681 unspecified role unspecified role neutral component neutral component region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 725683 unspecified role unspecified role neutral component neutral component region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false Fig. 11 O43639 transfection; Q7L0Q8 transfection