IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ woodring-2004-4 c-Abl phosphorylates Dok1 to promote filopodia during cell spreading. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Woodring PJ., Meisenhelder J., Johnson SA., Zhou GL., Field J., Shah K., Bladt F., Pawson T., Niki M., Pandolfi PP., Wang JY., Hunter T. Apoptosis - Interactions involving proteins with a function related to apoptosis SH2 domian of C-Abl was immobilised on the beads and lysates from latrunculin treated cells used. 2A, 2B, 2C hunter@salk.edu J. Cell Biol. (0021-9525) 2004 Only protein-protein interactions imex curation woodring-2004-3 c-Abl phosphorylates Dok1 to promote filopodia during cell spreading. mouse-embryonic_fibroblast Mus musculus embryonic fibroblasts embryonic_fibroblast Embryonic fibroblast Fibroblasts taken from an embryonic as opposed to a foetal or adult source. Foetus is defined as the stage at which tissue diferentiation is initiated. Tissue taken from an embryonic as opposed to a foetal or adult source. Embryo is defined as the development stage prior to organ formation. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Woodring PJ., Meisenhelder J., Johnson SA., Zhou GL., Field J., Shah K., Bladt F., Pawson T., Niki M., Pandolfi PP., Wang JY., Hunter T. Apoptosis - Interactions involving proteins with a function related to apoptosis SH2 domian of C-Abl was immobilised on the beads and lysates from latrunculin treated cells used. 2A, 2B, 2C hunter@salk.edu J. Cell Biol. (0021-9525) 2004 Only protein-protein interactions imex curation woodring-2004-1 c-Abl phosphorylates Dok1 to promote filopodia during cell spreading. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Woodring PJ., Meisenhelder J., Johnson SA., Zhou GL., Field J., Shah K., Bladt F., Pawson T., Niki M., Pandolfi PP., Wang JY., Hunter T. Apoptosis - Interactions involving proteins with a function related to apoptosis SH2 domian of C-Abl was immobilised on the beads and lysates from latrunculin treated cells used. 2A, 2B, 2C hunter@salk.edu J. Cell Biol. (0021-9525) 2004 Only protein-protein interactions imex curation woodring-2004-2 c-Abl phosphorylates Dok1 to promote filopodia during cell spreading. in vitro In vitro kinase htrf kinase homogeneous time resolved fluorescence kinase HTRF homogeneous time-resolved fluorescence kinase htrf predetermined predetermined participant predetermined Woodring PJ., Meisenhelder J., Johnson SA., Zhou GL., Field J., Shah K., Bladt F., Pawson T., Niki M., Pandolfi PP., Wang JY., Hunter T. Apoptosis - Interactions involving proteins with a function related to apoptosis SH2 domian of C-Abl was immobilised on the beads and lysates from latrunculin treated cells used. 2A, 2B, 2C hunter@salk.edu J. Cell Biol. (0021-9525) 2004 Only protein-protein interactions imex curation woodring-2004-5 c-Abl phosphorylates Dok1 to promote filopodia during cell spreading. mouse-embryonic_fibroblast Mus musculus embryonic fibroblasts embryonic_fibroblast Embryonic fibroblast Fibroblasts taken from an embryonic as opposed to a foetal or adult source. Foetus is defined as the stage at which tissue diferentiation is initiated. Tissue taken from an embryonic as opposed to a foetal or adult source. Embryo is defined as the development stage prior to organ formation. fluorescence imaging fluorescence microscopy fluorescence imaging predetermined predetermined participant predetermined Woodring PJ., Meisenhelder J., Johnson SA., Zhou GL., Field J., Shah K., Bladt F., Pawson T., Niki M., Pandolfi PP., Wang JY., Hunter T. Apoptosis - Interactions involving proteins with a function related to apoptosis SH2 domian of C-Abl was immobilised on the beads and lysates from latrunculin treated cells used. 2A, 2B, 2C hunter@salk.edu J. Cell Biol. (0021-9525) 2004 Only protein-protein interactions imex curation abl1_mouse Tyrosine-protein kinase ABL1 Abl1 Abl Abelson murine leukemia viral oncogene homolog 1 Proto-oncogene c-Abl p150 Abelson tyrosine-protein kinase 1 protein protein mouse Mus musculus Mouse MLEICLKLVGCKSKKGLSSSSSCYLEEALQRPVASDFEPQGLSEAARWNSKENLLAGPSENDPNLFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCEAQTKNGQGWVPSNYITPVNSLEKHSWYHGPVSRNAAEYLLSSGINGSFLVRESESSPGQRSISLRYEGRVYHYRINTASDGKLYVSSESRFNTLAELVHHHSTVADGLITTLHYPAPKRNKPTIYGVSPNYDKWEMERTDITMKHKLGGGQYGEVYEGVWKKYSLTVAVKTLKEDTMEVEEFLKEAAVMKEIKHPNLVQLLGVCTREPPFYIITEFMTYGNLLDYLRECNRQEVSAVVLLYMATQISSAMEYLEKKNFIHRDLAARNCLVGENHLVKVADFGLSRLMTGDTYTAHAGAKFPIKWTAPESLAYNKFSIKSDVWAFGVLLWEIATYGMSPYPGIDLSQVYELLEKDYRMERPEGCPEKVYELMRACWQWNPSDRPSFAEIHQAFETMFQESSISDEVEKELGKRGTRGGAGSMLQAPELPTKTRTCRRAAEQKDAPDTPELLHTKGLGESDALDSEPAVSPLLPRKERGPPDGSLNEDERLLPRDRKTNLFSALIKKKKKMAPTPPKRSSSFREMDGQPDRRGASEDDSRELCNGPPALTSDAAEPTKSPKASNGAGVPNGAFREPGNSGFRSPHMWKKSSTLTGSRLAAAEEESGMSSSKRFLRSCSASCMPHGARDTEWRSVTLPRDLPSAGKQFDSSTFGGHKSEKPALPRKRTSESRSEQVAKSTAMPPPRLVKKNEEAAEEGFKDTESSPGSSPPSLTPKLLRRQVTASPSSGLSHKEEATKGSASGMGTPATAEPAPPSNKVGLSKASSEEMRVRRHKHSSESPGRDKGRLAKLKPAPPPPPACTGKAGKPAQSPSQEAGEAGGPTKTKCTSLAMDAVNTDPTKAGPPGEGLRKPVPPSVPKPQSTAKPPGTPTSPVSTPSTAPAPSPLAGDQQPSSAAFIPLISTRVSLRKTRQPPERIASGTITKGVVLDSTEALCLAISRNSEQMASHSAVLEAGKNLYTFCVSYVDSIQQMRNKFAFREAINKLESNLRELQICPATASSGPAATQDFSKLLSSVKEISDIVRR nck1_mouse Cytoplasmic protein NCK1 Nck1 NCK adaptor protein 1 protein protein mouse Mus musculus Mouse MAEEVVVVAKFDYVAQQEQELDIKKNERLWLLDDSKSWWRVRNSMNKTGFVPSNYVERKNSARKASIVKNLKDTLGIGKVKRKPSVPDTASPADDSFVDPGERLYDLNMPAFVKFNYMAEREDELSLIKGTKVIVMEKCSDGWWRGSYNGQIGWFPSNYVTEEGDSPLGDHVGSLSEKLAAVVNNLNTGQVLHVVQALYPFSSSNDEELNFEKGDVMDVIEKPENDPEWWKCRKINGMVGLVPKNYVTIMQNNPLTSGLEPSPPQCDYIRPSLTGKFAGNPWYYGKVTRHQAEMALNERGHEGDFLIRDSESSPNDFSVSLKAQGKNKHFKVQLKETVYCIGQRKFSTMEELVEHYKKAPIFTSEQGEKLYLVKHLS dok1_mouse Docking protein 1 Downstream of tyrosine kinase 1 p62(dok) Dok1 Dok protein protein mouse Mus musculus Mouse MDGAVMEGPLFLQSQRFGTKRWRKTWAVLYPASPHGVARLEFFDHKGSSSRGGRGGSRRLDCKMIRLAECVSVVPVTVESPPEPGAVAFRLDTAQRSHLLAADAVSSTAWVQTLCRTAFPKGGWALAQTENQPKFSALEMLENSLYSPTWEGSQFWVTSQKTEASERCGLQGSYILRVEAEKLTLLTLGAQSQILEPLLFWPYTLLRRYGRDKVMFSFEAGRRCPSGPGTFTFQTSQGNDIFQAVEAAIQQQKAQGKVGQAQDILRTDSHDGETEGKTVPPPVPQDPLGSPPALYAEPLDSLRIPPGPSQDSVYSDPLGSTPAGAGEGVHSKKPLYWDLYGHVQQQLLKTKLTDSKEDPIYDEPEGLAPAPPRGLYDLPQEPRDAWWCQARLKEEGYELPYNPATDDYAVPPPRSPKPAPAPKPQGLILPESGTTRGSGSKGFSSDTALYSQVQKSGTSGAWDCGLSKVGNDRAGVKSEGST dok1-nck1-2 362578 N/A 362583 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 362584 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 362585 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false tyr 361 requied optyr O4'-phospho-L-tyrosine (2S)-2-amino-3-(4-phosphonooxyphenyl)propanoic acid 2-azanyl-3-(4-phosphonooxyphenyl)propanoic acid MOD_RES Phosphotyrosine O4-phosphotyrosine tyrosine phosphate 2-amino-3-(4-hydroxyphenyl)propanoic acid 4'-phosphate O4'-phospho-L-tyrosine O4'-phosphorylated L-tyrosine OPTyr Phospho Phospho Tyrosinyl Phosphorylation phosphorylationy certain certain sequence position certain certain certain sequence position certain false P97465:p.Tyr361Phe mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false association association false false false Tyr 361 of Dok1 was necessary for interaction of Nck1 with Dok1. Tyr 361 of Dok1 and Tyr 412 of Abl obtained by CoIp were phosphorylated. ST1571 dok1-abl1 362578 N/A 362585 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 362583 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Tyr 361 of Dok1 and Tyr 412 of Abl were phosphorylated. Abl:Dok1 coimmunoprecipitation was decreased by ST1571 abl1-nck1 362578 N/A 362584 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 362583 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Increased levels of Dok1 MEFs were pretreated with DMSO dok1-nck1 362579 N/A 362584 unspecified role unspecified role prey prey N/A 362585 unspecified role unspecified role bait bait P97465:p.Tyr361Phe required mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false tyr361 optyr O4'-phospho-L-tyrosine (2S)-2-amino-3-(4-phosphonooxyphenyl)propanoic acid 2-azanyl-3-(4-phosphonooxyphenyl)propanoic acid MOD_RES Phosphotyrosine O4-phosphotyrosine tyrosine phosphate 2-amino-3-(4-hydroxyphenyl)propanoic acid 4'-phosphate O4'-phospho-L-tyrosine O4'-phosphorylated L-tyrosine OPTyr Phospho Phospho Tyrosinyl Phosphorylation phosphorylationy certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false dok1-nck1-1 362579 N/A 362585 unspecified role unspecified role prey prey tyr361 requied optyr O4'-phospho-L-tyrosine (2S)-2-amino-3-(4-phosphonooxyphenyl)propanoic acid 2-azanyl-3-(4-phosphonooxyphenyl)propanoic acid MOD_RES Phosphotyrosine O4-phosphotyrosine tyrosine phosphate 2-amino-3-(4-hydroxyphenyl)propanoic acid 4'-phosphate O4'-phospho-L-tyrosine O4'-phosphorylated L-tyrosine OPTyr Phospho Phospho Tyrosinyl Phosphorylation phosphorylationy certain certain sequence position certain certain certain sequence position certain false P97465:p.Tyr361Phe mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false N/A 362584 unspecified role unspecified role bait bait physical association physical association false false false abl1-dok1 362580 N/A 362585 unspecified role unspecified role prey prey mouse-embryonic_fibroblast Mus musculus embryonic fibroblasts embryonic_fibroblast Embryonic fibroblast Fibroblasts taken from an embryonic as opposed to a foetal or adult source. Foetus is defined as the stage at which tissue diferentiation is initiated. Tissue taken from an embryonic as opposed to a foetal or adult source. Embryo is defined as the development stage prior to organ formation. N/A 362583 unspecified role unspecified role bait bait sh2 domain sufficient to bind sufficient binding region sufficient to bind range range range range false direct interaction direct interaction false false false Y361 of Dok1 is phosphorylated by c-ABbl. This is blocked by ST1571. abl1-dok1-1 362581 N/A 362583 enzyme enzyme unspecified role unspecified role N/A 362585 enzyme target enzyme target substrate substrate unspecified role unspecified role region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) phosphorylation phosphorylation reaction phosphorylation false false false Eight prominant tryptic phosphopeptides were identified. Tyr 361 is phosphorylated dok1-abl1-1 362582 N/A 362585 unspecified role unspecified role neutral component neutral component N/A 362583 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false Dok1, pTyr, and c-Abl localize to the tips of filopodia and peripheral actin microspikes