IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ jeong-2004a-5 Bcl-x(L) sequesters its C-terminal membrane anchor in soluble, cytosolic homodimers. chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Jeong SY., Gaume B., Lee YJ., Hsu YT., Ryu SW., Yoon SH., Youle RJ. Apoptosis - Interactions involving proteins with a function related to apoptosis Homodimer formation identified by molecular weight following column calibration. 1A youle@helix.nih.gov EMBO J. (0261-4189) 2004 jeong-2004a-6 Bcl-x(L) sequesters its C-terminal membrane anchor in soluble, cytosolic homodimers. chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Jeong SY., Gaume B., Lee YJ., Hsu YT., Ryu SW., Yoon SH., Youle RJ. Apoptosis - Interactions involving proteins with a function related to apoptosis Bcl-xL and Bax do not normally bind one another in the cytosol of healthy cells, nonionic detergents such as Triton X-100 will initiate heterodimer formation. Homodimer formation identified by molecular weight following column calibration. 1A youle@helix.nih.gov EMBO J. (0261-4189) 2004 jeong-2004a-1 Bcl-x(L) sequesters its C-terminal membrane anchor in soluble, cytosolic homodimers. human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column western blot western blot Immuno blot Immuno blot Jeong SY., Gaume B., Lee YJ., Hsu YT., Ryu SW., Yoon SH., Youle RJ. Apoptosis - Interactions involving proteins with a function related to apoptosis Homodimer formation identified by molecular weight following column calibration. 1A youle@helix.nih.gov EMBO J. (0261-4189) 2004 jeong-2004a-2 Bcl-x(L) sequesters its C-terminal membrane anchor in soluble, cytosolic homodimers. human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 crosslink cross-linking study crosslink western blot western blot Immuno blot Immuno blot Jeong SY., Gaume B., Lee YJ., Hsu YT., Ryu SW., Yoon SH., Youle RJ. Apoptosis - Interactions involving proteins with a function related to apoptosis Homodimer formation identified by molecular weight following column calibration. 1A youle@helix.nih.gov EMBO J. (0261-4189) 2004 jeong-2004a-3 Bcl-x(L) sequesters its C-terminal membrane anchor in soluble, cytosolic homodimers. chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 crosslink cross-linking study crosslink western blot western blot Immuno blot Immuno blot Jeong SY., Gaume B., Lee YJ., Hsu YT., Ryu SW., Yoon SH., Youle RJ. Apoptosis - Interactions involving proteins with a function related to apoptosis Homodimer formation identified by molecular weight following column calibration. 1A youle@helix.nih.gov EMBO J. (0261-4189) 2004 jeong-2004a-4 Bcl-x(L) sequesters its C-terminal membrane anchor in soluble, cytosolic homodimers. human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Jeong SY., Gaume B., Lee YJ., Hsu YT., Ryu SW., Yoon SH., Youle RJ. Apoptosis - Interactions involving proteins with a function related to apoptosis Homodimer formation identified by molecular weight following column calibration. 1A youle@helix.nih.gov EMBO J. (0261-4189) 2004 q07817-1 Bcl-2-like protein 1 BCLX Apoptosis regulator Bcl-X BCL2L1 BCL2L Bcl-xL protein protein human Homo sapiens Human MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLADSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK bad_human Bcl2-associated agonist of cell death Bcl-2-binding component 6 Bcl-2-like protein 8 BAD BBC6 BCL2L8 Bcl-xL/Bcl-2-associated death promoter Bcl2 antagonist of cell death protein protein human Homo sapiens Human MFQIPEFEPSEQEDSSSAERGLGPSPAGDGPSGSGKHHRQAPGLLWDASHQQEQPTSSSHHGGAGAVEIRSRHSSYPAGTEDDEGMGEEPSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSFKKGLPRPKSAGTATQMRQSSSWTRVFQSWWDRNLGRGSSAPSQ bax_human Apoptosis regulator BAX BAX BCL2L4 Bcl-2-like protein 4 protein protein human Homo sapiens Human MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGTPTWQTVTIFVAGVLTASLTIWKKMG q64373-1 Bcl-2-like protein 1 Bcl2l1 Bcl2l Bclx Apoptosis regulator Bcl-X Bcl-xL protein protein mouse Mus musculus Mouse MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEETEAERETPSAINGNPSWHLADSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIASWMATYLNDHLEPWIQENGGWDTFVDLYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK bclxl-bclxl-5 Homodimerisation of Bcl-XL identified following coimmunoprecipitation 219851 N/A 219857 unspecified role unspecified role prey prey Q07817-1:p.Lys233Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false Q07817-1:p.Arg232Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 219857 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false The presence of basic amino acids in the C-tail is required for homodimerization, Bcl-xL insertion into the mitochondrial targeting membrane and protection against induced cell death By BAD, which heterodimerizes with BCL-XL bclxl-bclxl-6 Homodimerisation of Bcl-XL identified following coimmunoprecipitation 219851 N/A 219857 unspecified role unspecified role prey prey N/A 219857 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region binding region binding-associated region binding region deletion analysis deletion analysis undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Q07817-1:p.Arg232Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false Q07817-1:p.Lys233Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false The presence of basic amino acids in the C-tail is required for homodimerization, Bcl-xL insertion into the mitochondrial targeting membrane and protection against induced cell death bclxl-bad-1 Interaction of Bcl-XL with BAD identified following coimmunoprecipitation 219851 N/A 219857 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 219858 unspecified role unspecified role prey prey physical association physical association false false false bclxl-bclxl-7 Homodimerisation of Bcl-XL identified following coimmunoprecipitation 219851 N/A 219857 unspecified role unspecified role prey prey Q07817-1:p.Gly138Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false N/A 219857 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false bclxl-bax-1 Interaction of Bcl-XL with BAX identified following coimmunoprecipitation 219852 N/A 219859 unspecified role unspecified role prey prey N/A 219857 unspecified role unspecified role bait bait region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false bclxl-bax-2 Interaction of Bcl-XL with BAX identified following coimmunoprecipitation 219852 N/A 219859 unspecified role unspecified role bait bait N/A 219857 unspecified role unspecified role prey prey region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Q07817-1:p.Leu226Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false Q07817-1:p.Leu226Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false Q07817-1:p.Gly227Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false bclxl-bax-3 Interaction of Bcl-XL with BAX identified following coimmunoprecipitation 219852 N/A 219857 unspecified role unspecified role prey prey N/A 219859 unspecified role unspecified role bait bait region binding region binding-associated region binding region deletion analysis deletion analysis undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false bclxl-bclxl-1 Homodimerisation of Bcl-XL identified following gel filtration 219853 N/A 219857 unspecified role unspecified role neutral component neutral component Stoichiometry: 2.0 physical association physical association false false false bclxl-bclxl-2 Homodimerisation of Bcl-XL identified following chemical crosslinking 219854 N/A 219857 unspecified role unspecified role neutral component neutral component Stoichiometry: 2.0 physical association physical association false false false bclxl-bclxl-3 Homodimerisation of Bcl-XL identified following chemical crosslinking 219855 N/A 219857 unspecified role unspecified role neutral component neutral component Stoichiometry: 2.0 physical association physical association false false false bclxl-bclxl-4 Homodimerisation of human and mouse Bcl-XL identified following coimmunopreciptiation 219856 N/A 219857 unspecified role unspecified role bait bait N/A 219860 unspecified role unspecified role prey prey physical association physical association false false false