IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ wang-2004b-2 The yeast split-ubiquitin membrane protein two-hybrid screen identifies BAP31 as a regulator of the turnover of endoplasmic reticulum-associated protein tyrosine phosphatase-like B. chlae-cos_1 Chlorocebus aethiops COS-1 cells Grivet cos_1 CV-1 Simian cells (cercopithecus aethiops) transformed by SV40 anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Wang B., Pelletier J., Massaad MJ., Herscovics A., Shore GC. Apoptosis - Interactions involving proteins with a function related to apoptosis Mol. Cell. Biol. (0270-7306) 2004 wang-2004b-1 The yeast split-ubiquitin membrane protein two-hybrid screen identifies BAP31 as a regulator of the turnover of endoplasmic reticulum-associated protein tyrosine phosphatase-like B. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast ub reconstruction ubiquitin reconstruction ub reconstruction nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Wang B., Pelletier J., Massaad MJ., Herscovics A., Shore GC. Apoptosis - Interactions involving proteins with a function related to apoptosis Mol. Cell. Biol. (0270-7306) 2004 wang-2004b-3 The yeast split-ubiquitin membrane protein two-hybrid screen identifies BAP31 as a regulator of the turnover of endoplasmic reticulum-associated protein tyrosine phosphatase-like B. chlae-cos_1 Chlorocebus aethiops COS-1 cells Grivet cos_1 CV-1 Simian cells (cercopithecus aethiops) transformed by SV40 fluorescence imaging fluorescence microscopy fluorescence imaging predetermined predetermined participant predetermined Wang B., Pelletier J., Massaad MJ., Herscovics A., Shore GC. Apoptosis - Interactions involving proteins with a function related to apoptosis Mol. Cell. Biol. (0270-7306) 2004 bap31_human B-cell receptor-associated protein 31 BCAP31 BAP31 p28 6C6-AG tumor-associated antigen DXS1357E Protein CDM protein protein human Homo sapiens Human MSLQWTAVATFLYAEVFVVLLLCIPFISPKRWQKIFKSRLVELLVSYGNTFFVVLIVILVLLVIDAVREIRKYDDVTEKVNLQNNPGAMEHFHMKLFRAQRNLYIAGFSLLLSFLLRRLVTLISQQATLLASNEAFKKQAESASEAAKKYMEENDQLKKGAAVDGGKLDVGNAEVKLEEENRSLKADLQKLKDELASTKQKLEKAENQVLAMRKQSEGLTKEYDRLLEEHAKLQAAVDGPMDKKEE hacd2_human Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 2 HACD2 3-hydroxyacyl-CoA dehydratase 2 PTPLB Protein-tyrosine phosphatase-like member B protein protein human Homo sapiens Human MAAVAATAAAKGNGGGGGRAGAGDASGTRKKKGPGPLATAYLVIYNVVMTAGWLVIAVGLVRAYLAKGSYHSLYYSIEKPLKFFQTGALLEILHCAIGIVPSSVVLTSFQVMSRVFLIWAVTHSVKEVQSEDSVLLFVIAWTITEIIRYSFYTFSLLNHLPYLIKWARYTLFIVLYPMGVSGELLTIYAALPFVRQAGLYSISLPNKYNFSFDYYAFLILIMISYIPIFPQLYFHMIHQRRKILSHTEEHKKFE bap31-ptplb-2 Interaction between the integral membrane proteins BAP31 and PTPBL detected by anti-HA coIP 177953 N/A 177956 unspecified role unspecified role prey prey c-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 177957 unspecified role unspecified role bait bait c-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag western blot western blot Immuno blot Immuno blot c-term range C-terminal range c-term range c-term range C-terminal range c-term range false n-terminal myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false bap31-ptplb-3 Interaction between the integral membrane proteins BAP31 and PTPBL detected by anti-FLAG coIP 177953 N/A 177957 unspecified role unspecified role prey prey c-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag western blot western blot Immuno blot Immuno blot c-term range C-terminal range c-term range c-term range C-terminal range c-term range false n-terminal myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 177956 unspecified role unspecified role bait bait c-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false bap31-ptplb-1 Interaction between the integral membrane proteins BAP31 and PTPBL detected by Y2H ubiquitin reconstruction 177954 N/A 177956 unspecified role unspecified role bait bait c-terminal cub-plv tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 177957 unspecified role unspecified role prey prey n-terminal nubg tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false bap31-ptplb-4 colocalization of the integral membrane proteins BAP31 and PTPBL 177955 N/A 177956 unspecified role unspecified role neutral component neutral component N/A 177957 unspecified role unspecified role neutral component neutral component c-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag western blot western blot Immuno blot Immuno blot c-term range C-terminal range c-term range c-term range C-terminal range c-term range false colocalization colocalization false false false BAP31 is endogenous