IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ jan-2004-2 A mitochondrial protein, Bit1, mediates apoptosis regulated by integrins and Groucho/TLE corepressors. human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Jan Y., Matter M., Pai J.T., Chen Y.L., Pilch J., Komatsu M., Ong E., Fukuda M., Ruoslahti E. Apoptosis - Interactions involving proteins with a function related to apoptosis ruoslahti@burnham.org Human fetal brain cDNA library. Cell (0092-8674) 2004 Only protein-protein interactions imex curation jan-2004-1 A mitochondrial protein, Bit1, mediates apoptosis regulated by integrins and Groucho/TLE corepressors. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Jan Y., Matter M., Pai J.T., Chen Y.L., Pilch J., Komatsu M., Ong E., Fukuda M., Ruoslahti E. Apoptosis - Interactions involving proteins with a function related to apoptosis ruoslahti@burnham.org Human fetal brain cDNA library. Cell (0092-8674) 2004 Only protein-protein interactions imex curation jan-2004-3 A mitochondrial protein, Bit1, mediates apoptosis regulated by integrins and Groucho/TLE corepressors. human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Jan Y., Matter M., Pai J.T., Chen Y.L., Pilch J., Komatsu M., Ong E., Fukuda M., Ruoslahti E. Apoptosis - Interactions involving proteins with a function related to apoptosis ruoslahti@burnham.org Human fetal brain cDNA library. Cell (0092-8674) 2004 Only protein-protein interactions imex curation jan-2004-4 A mitochondrial protein, Bit1, mediates apoptosis regulated by integrins and Groucho/TLE corepressors. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Jan Y., Matter M., Pai J.T., Chen Y.L., Pilch J., Komatsu M., Ong E., Fukuda M., Ruoslahti E. Apoptosis - Interactions involving proteins with a function related to apoptosis ruoslahti@burnham.org Human fetal brain cDNA library. Cell (0092-8674) 2004 Only protein-protein interactions imex curation pth2_human Peptidyl-tRNA hydrolase 2, mitochondrial PTRH2 BIT1 PTH2 CGI-147 Bcl-2 inhibitor of transcription 1 protein protein human Homo sapiens Human MPSKSLVMEYLAHPSTLGLAVGVACGMCLGWSLRVCFGMLPKSKTSKTHTDTESEASILGDSGEYKMILVVRNDLKMGKGKVAAQCSHAAVSAYKQIQRRNPEMLKQWEYCGQPKVVVKAPDEETLIALLAHAKMLGLTVSLIQDAGRTQIAPGSQTVLGIGPGPADLIDKVTGHLKLY tle5_human TLE family member 5 TLE5 AES Amino-terminal enhancer of split GRG GRG5 Gp130-associated protein GAM Grg-5 Groucho-related protein 5 Protein ESP1 Protein GRG TLE family member 5, transcriptional modulator protein protein human Homo sapiens Human MMFPQSRHSGSSHLPQQLKFTTSDSCDRIKDEFQLLQAQYHSLKLECDKLASEKSEMQRHYVMYYEMSYGLNIEMHKQAEIVKRLNGICAQVLPYLSQEHQQQVLGAIERAKQVTAPELNSIIRQQLQAHQLSQLQALALPLTPLPVGLQPPSLPAVSAGTGLLSLSALGSQAHLSKEDKNGHDGDTHQEDDGEKSD ptrh2-aes-2 1322657 n/a 1322661 unspecified role unspecified role bait bait n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n/a 1322662 unspecified role unspecified role prey prey n-terminal myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false 3a Bit1 (ptrh2) must bear an N-terminal tag, so the protein will localize in the cytosol and the interaction can happen. aes-ptrh2 1322657 n/a 1322662 unspecified role unspecified role bait bait n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n/a 1322661 unspecified role unspecified role prey prey n-terminal myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false 3a and 5d Bit1 (ptrh2) must bear an N-terminal tag, so the protein will localize in the cytosol and the intraction can happen. Culturing the cells with fibronectin decreases detachment and reduces the interaction. aes-ptrh2-1 1322657 n/a 1322661 unspecified role unspecified role prey prey c-terminal myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false n/a 1322662 unspecified role unspecified role bait bait n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false 3c Cells must undergo programmed cell death indicued by detachment (anoikis) for ptrh2 to be released into the cytosol and the interaction to take place. ptrh2-aes-1 1322658 n/a 1322661 unspecified role unspecified role bait bait n/a 1322662 unspecified role unspecified role prey prey physical association physical association false false false text ptrh2-aes-3 1322659 n/a 1322662 unspecified role unspecified role prey prey n/a 1322661 unspecified role unspecified role bait bait physical association physical association false false false 3b Interaction happens in the event of programmed cell death due to cell detachment (anoikis). aes-ptrh2-2 1322660 n/a 1322661 unspecified role unspecified role prey prey n-terminal myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n/a 1322662 unspecified role unspecified role bait bait n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false 5c Bit1 (ptrh2) must bear an N-terminal tag, so the protein will localize in the cytosol and the intraction can happen. Co-expression with TLE1 decreases the interaction.