IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ kim-2003a-2 Cloning and characterization of GITR ligand. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. facs fluorescence-activated cell sorting FACS Flow cytometry facs monoclonal western monoclonal antibody western blot monoclonal western Kim JD., Choi BK., Bae JS., Lee UH., Han IS., Lee HW., Youn BS., Vinay DS., Kwon BS. Apoptosis - Interactions involving proteins with a function related to apoptosis Genes Immun. (1466-4879) 2003 kim-2003a-1 Cloning and characterization of GITR ligand. in vitro In vitro pull down pull down predetermined predetermined participant predetermined Kim JD., Choi BK., Bae JS., Lee UH., Han IS., Lee HW., Youn BS., Vinay DS., Kwon BS. Apoptosis - Interactions involving proteins with a function related to apoptosis Genes Immun. (1466-4879) 2003 tnf18_mouse Tumor necrosis factor ligand superfamily member 18 Gitrl Tnfsf18 GITR ligand Glucocorticoid-induced TNF-related ligand protein protein mouse Mus musculus Mouse MEEMPLRESSPQRAERCKKSWLLCIVALLLMLLCSLGTLIYTSLKPTAIESCMVKFELSSSKWHMTSPKPHCVNTTSDGKLKILQSGTYLIYGQVIPVDKKYIKDNAPFVVQIYKKNDVLQTLMNDFQILPIGGVYELHAGDNIYLKFNSKDHIQKTNTYWGIILMPDLPFIS tnr18_mouse Tumor necrosis factor receptor superfamily member 18 Glucocorticoid-induced TNFR-related protein Tnfrsf18 Gitr protein protein mouse Mus musculus Mouse MGAWAMLYGVSMLCVLDLGQPSVVEEPGCGPGKVQNGSGNNTRCCSLYAPGKEDCPKERCICVTPEYHCGDPQCKICKHYPCQPGQRVESQGDIVFGFRCVACAMGTFSAGRDGHCRLWTNCSQFGFLTMFPGNKTHNAVCIPEPLPTEQYGHLTVIFLVMAACIFFLTTVQLGLHIWQLRRQHMCPRETQPFAEVQLSAEDACSFQFPEEERGEQTEEKCHLGGRWP gitr-gitrl-1 FACS analysis demonstrates that the glucocorticoid-induced-tumor necrosis factor receptor (GITR) protein binds the glucocorticoid-induced-tumor necrosis factor receptor ligand (GITRL) protein 175269 N/A 175271 unspecified role unspecified role bait bait N/A 175272 unspecified role unspecified role prey prey region Fc domain of Ig tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) physical association physical association false false false gitr-gitrl-2 FACS analysis demonstrates that the glucocorticoid-induced-tumor necrosis factor receptor ligand (GITRL) protein binds the glucocorticoid-induced-tumor necrosis factor receptor (GITR) protein 175269 N/A 175271 unspecified role unspecified role prey prey n terminal CD8 extracellular domain tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) N/A 175272 unspecified role unspecified role bait bait physical association physical association false false false gitr-gitrl GST-pulldown demonstrates that the glucocorticoid-induced-tumor necrosis factor receptor (GITR) protein binds the glucocorticoid-induced-tumor necrosis factor receptor ligand (GITRL) protein 175270 N/A 175272 unspecified role unspecified role prey prey s35 radiolabel radiolabelled radiolabel radiolabeled radiolabelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 175271 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecobb Escherichia coli (strain B / BL21) physical association physical association false false false