IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ wong-2004-1 Identification and characterization of human VCY2-interacting protein: VCY2IP-1, a microtubule-associated protein-like protein. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Wong EY., Tse JY., Yao KM., Lui VC., Tam PC., Yeung WS. Apoptosis - Interactions involving proteins with a function related to apoptosis jymtse@yahoo.com.hk Human testis cDNA Biol. Reprod. (0006-3363) 2004 Only protein-protein interactions imex curation wong-2004-2 Identification and characterization of human VCY2-interacting protein: VCY2IP-1, a microtubule-associated protein-like protein. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast two hybrid pooling two hybrid pooling approach two hybrid pooling predetermined predetermined participant predetermined Wong EY., Tse JY., Yao KM., Lui VC., Tam PC., Yeung WS. Apoptosis - Interactions involving proteins with a function related to apoptosis jymtse@yahoo.com.hk Human testis cDNA Biol. Reprod. (0006-3363) 2004 Only protein-protein interactions imex curation wong-2004-3 Identification and characterization of human VCY2-interacting protein: VCY2IP-1, a microtubule-associated protein-like protein. in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Wong EY., Tse JY., Yao KM., Lui VC., Tam PC., Yeung WS. Apoptosis - Interactions involving proteins with a function related to apoptosis jymtse@yahoo.com.hk Human testis cDNA Biol. Reprod. (0006-3363) 2004 Only protein-protein interactions imex curation map1s_human Microtubule-associated protein 1S MAP1S BPY2IP1 C19orf5 MAP8 VCY2IP1 BPY2-interacting protein 1 Microtubule-associated protein 8 Variable charge Y chromosome 2-interacting protein 1 protein protein human Homo sapiens Human MAAVAGSGAAAAPSSLLLVVGSEFGSPGLLTYVLEELERGIRSWDVDPGVCNLDEQLKVFVSRHSATFSSIVKGQRSLHHRGDNLETLVLLNPSDKSLYDELRNLLLDPASHKLLVLAGPCLEETGELLLQTGGFSPHHFLQVLKDREIRDILATTPPPVQPPILTITCPTFGDWAQLAPAVPGLQGALRLQLRLNPPAQLPNSEGLCEFLEYVAESLEPPSPFELLEPPTSGGFLRLGRPCCYIFPGGLGDAAFFAVNGFTVLVNGGSNPKSSFWKLVRHLDRVDAVLVTHPGADSLPGLNSLLRRKLAERSEVAAGGGSWDDRLRRLISPNLGVVFFNACEAASRLARGEDEAELALSLLAQLGITPLPLSRGPVPAKPTVLFEKMGVGRLDMYVLHPPSAGAERTLASVCALLVWHPAGPGEKVVRVLFPGCTPPACLLDGLVRLQHLRFLREPVVTPQDLEGPGRAESKESVGSRDSSKREGLLATHPRPGQERPGVARKEPARAEAPRKTEKEAKTPRELKKDPKPSVSRTQPREVRRAASSVPNLKKTNAQAAPKPRKAPSTSHSGFPPVANGPRSPPSLRCGEASPPSAACGSPASQLVATPSLELGPIPAGEEKALELPLAASSIPRPRTPSPESHRSPAEGSERLSLSPLRGGEAGPDASPTVTTPTVTTPSLPAEVGSPHSTEVDESLSVSFEQVLPPSAPTSEAGLSLPLRGPRARRSASPHDVDLCLVSPCEFEHRKAVPMAPAPASPGSSNDSSARSQERAGGLGAEETPPTSVSESLPTLSDSDPVPLAPGAADSDEDTEGFGVPRHDPLPDPLKVPPPLPDPSSICMVDPEMLPPKTARQTENVSRTRKPLARPNSRAAAPKATPVAAAKTKGLAGGDRASRPLSARSEPSEKGGRAPLSRKSSTPKTATRGPSGSASSRPGVSATPPKSPVYLDLAYLPSGSSAHLVDEEFFQRVRALCYVISGQDQRKEEGMRAVLDALLASKQHWDRDLQVTLIPTFDSVAMHTWYAETHARHQALGITVLGSNSMVSMQDDAFPACKVEF vcy2_human Testis-specific basic protein Y 2 BPY2C BPY2A BPY2 BPY2B VCY2 VCY2A VCY2B VCY2C Variably charged protein Y 2 Basic charge, Y-linked 2 protein protein human Homo sapiens Human MMTLVPRARTRAGQDHYSHPCPRFSQVLLTEGIMTYCLTKNLSDVNILHRLLKNGNVRNTLLQSKVGLLTYYVKLYPGEVTLLTRPSIQMRLCCITGSVSRPRSQK by2-map1s-1 Interaction between BY2 (VCY2) and MAP1S (VCY2IP-1) identified by Y2H 787225 n/a 787228 unspecified role unspecified role prey prey n/a 787229 unspecified role unspecified role bait bait physical association physical association false false false by2-map1s-2 Interaction between BY2 (VCY2) and MAP1S (VCY2IP-1) identified by Y2H 787226 n/a 787229 unspecified role unspecified role bait bait n/a 787228 unspecified role unspecified role prey prey physical association physical association false false false Fig. 1 by2-map1s-3 Interaction between BY2 (VCY2) and MAP1S (VCY2IP-1) identified by coimmunoprecipitation 787227 n/a 787229 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro n/a 787228 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro direct interaction direct interaction false false false Fig. 2