IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ kanamori-2003-4 The PDZ protein tax-interacting protein-1 inhibits beta-catenin transcriptional activity and growth of colorectal cancer cells. in vitro In vitro pull down pull down predetermined predetermined participant predetermined Kanamori M., Sandy P., Marzinotto S., Benetti R., Kai C., Hayashizaki Y., Schneider C., Suzuki H. Apoptosis - Interactions involving proteins with a function related to apoptosis A mammalian two hybrid assay was performed where interactions were monitored with the pG5luc reporter. rgscerg@gsc.riken.go.jp A library of approximately 15,000 mouse full-length cDNAs fused in frame with the DNA binding domain of Gal4 was used. J. Biol. Chem. (0021-9258) 2003 Cancer - Interactions investigated in the context of cancer kanamori-2003-5 The PDZ protein tax-interacting protein-1 inhibits beta-catenin transcriptional activity and growth of colorectal cancer cells. crigr-cho_k1 Cricetulus griseus ovary K1 cho_k1 Chinese Hamster Ovary K1 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Kanamori M., Sandy P., Marzinotto S., Benetti R., Kai C., Hayashizaki Y., Schneider C., Suzuki H. Apoptosis - Interactions involving proteins with a function related to apoptosis A mammalian two hybrid assay was performed where interactions were monitored with the pG5luc reporter. rgscerg@gsc.riken.go.jp A library of approximately 15,000 mouse full-length cDNAs fused in frame with the DNA binding domain of Gal4 was used. J. Biol. Chem. (0021-9258) 2003 Cancer - Interactions investigated in the context of cancer kanamori-2003-1 The PDZ protein tax-interacting protein-1 inhibits beta-catenin transcriptional activity and growth of colorectal cancer cells. crigr-cho_k1 Cricetulus griseus ovary K1 cho_k1 Chinese Hamster Ovary K1 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Kanamori M., Sandy P., Marzinotto S., Benetti R., Kai C., Hayashizaki Y., Schneider C., Suzuki H. Apoptosis - Interactions involving proteins with a function related to apoptosis A mammalian two hybrid assay was performed where interactions were monitored with the pG5luc reporter. rgscerg@gsc.riken.go.jp A library of approximately 15,000 mouse full-length cDNAs fused in frame with the DNA binding domain of Gal4 was used. J. Biol. Chem. (0021-9258) 2003 Cancer - Interactions investigated in the context of cancer kanamori-2003-2 The PDZ protein tax-interacting protein-1 inhibits beta-catenin transcriptional activity and growth of colorectal cancer cells. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Kanamori M., Sandy P., Marzinotto S., Benetti R., Kai C., Hayashizaki Y., Schneider C., Suzuki H. Apoptosis - Interactions involving proteins with a function related to apoptosis A mammalian two hybrid assay was performed where interactions were monitored with the pG5luc reporter. rgscerg@gsc.riken.go.jp A library of approximately 15,000 mouse full-length cDNAs fused in frame with the DNA binding domain of Gal4 was used. J. Biol. Chem. (0021-9258) 2003 Cancer - Interactions investigated in the context of cancer kanamori-2003-3 The PDZ protein tax-interacting protein-1 inhibits beta-catenin transcriptional activity and growth of colorectal cancer cells. human-u2-os Human U2-OS osteosarcoma cell line u2-os U2-OS osteocaroma cell line Not in CAPRI and no primary literature reference fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining Kanamori M., Sandy P., Marzinotto S., Benetti R., Kai C., Hayashizaki Y., Schneider C., Suzuki H. Apoptosis - Interactions involving proteins with a function related to apoptosis A mammalian two hybrid assay was performed where interactions were monitored with the pG5luc reporter. rgscerg@gsc.riken.go.jp A library of approximately 15,000 mouse full-length cDNAs fused in frame with the DNA binding domain of Gal4 was used. J. Biol. Chem. (0021-9258) 2003 Cancer - Interactions investigated in the context of cancer rtkn_mouse Rhotekin Rtkn protein protein mouse Mus musculus Mouse MFSRNHRSRITVARGSALEMEFKRGRFRLSFFSESPEDTELQRKLDHEIRMRDGACKLLAACSQREQALEATKSLLVCNSRILSYMGELQRRKEAQVLEKTGRRPSDSVQPAQHSPCRGRVCISDLRIPLMWKDTEYFKNKGDLHRWAVFLLLQIGEQIQDTEMVLVDRTLTDISFQNNVLFAEAEPDFELRLELYGACVEEEGALAGAPKRLATKLSSSLGRSSGKRVRASLDSAGASGNSPVLLPTPAVGGPRFHLLAHTTLTLEEVQDGFRTHDLTLTSHEENPAWLPLYGSVCCRLAAQPLCMIQPTASGALRVQQAGELQNGTLVHGVLKGTNLFCYWRSEDADTGQEPLFTIVINKETRVRAGELEQAPEWPFTLSISNKYGDDEVTNTLQLESREALQNWMEALWQLFFDMSQWRHCCDEVMKIETPAPRKPPQALAKQGSLYHEMAIEPLDDIAAVTDILAQREGTRLEPSPPWLAMFTDQPALPSSCSPASVAPVPTWMQPLPWGRPRTFSLDAAPADHSLGPSRSVAPLPPQRSPKSRGFYSKSQLGPWLQSPV tx1b3_mouse Tax1-binding protein 3 Tax interaction protein 1 Tax1bp3 protein protein mouse Mus musculus Mouse MSYTPGQPVTAVVQRVEIHKLRQGENLILGFSIGGGIDQDPSQNPFSEDKTDKGIYVTRVSEGGPAEIAGLQIGDKIMQVNGWDMTMVTHDQARKRLTKRSEEVVRLLVTRQSLQKAVQQSMLS ctnb1_mouse Catenin beta-1 Beta-catenin Ctnnb1 Catnb protein protein mouse Mus musculus Mouse MATQADLMELDMAMEPDRKAAVSHWQQQSYLDSGIHSGATTTAPSLSGKGNPEEEDVDTSQVLYEWEQGFSQSFTQEQVADIDGQYAMTRAQRVRAAMFPETLDEGMQIPSTQFDAAHPTNVQRLAEPSQMLKHAVVNLINYQDDAELATRAIPELTKLLNDEDQVVVNKAAVMVHQLSKKEASRHAIMRSPQMVSAIVRTMQNTNDVETARCTAGTLHNLSHHREGLLAIFKSGGIPALVKMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDCLQILAYGNQESKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALGLHLTDPSQRLVQNCLWTLRNLSDAATKQEGMEGLLGTLVQLLGSDDINVVTCAAGILSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEPAICALRHLTSRHQEAEMAQNAVRLHYGLPVVVKLLHPPSHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLLVRAHQDTQRRTSMGGTQQQFVEGVRMEEIVEGCTGALHILARDVHNRIVIRGLNTIPLFVQLLYSPIENIQRVAAGVLCELAQDKEAAEAIEAEGATAPLTELLHSRNEGVATYAAAVLFRMSEDKPQDYKKRLSVELTSSLFRTEPMAWNETADLGLDIGAQGEALGYRQDDPSYRSFHSGGYGQDALGMDPMMEHEMGGHHPGADYPVDGLPDLGHAQDLMDGLPPGDSNQLAWFDTDL q82235_9dela tax protein protein humt- Human T-lymphotropic virus 1 MAHFPGFRQSLLFGYPVYVFGDCVQGDWCPISGGLCSARLHRHALLATCPEHQITWDPIDGRVIGSALQFLIPRLPSFPTQRTSKTLKVLTPPITHTTPNIPPSFLQAMRKYSPFRNGYMEPTLGQHLPTLSFPDPGLRPQNLYTLWGGSVVCMYLYQLSPPITWPLLPHVIFCHPGQLGAFLTNVPYKRIEELLYKISLTTGALIILPEDCLPTTLFQPARAPVTLTAWQNGLLPFHSTLTTPGLIWTFTDGTPMISGPCPEDGQPSLVLQSSSFIFHKFQTKAYHPSFLLSHGLIQYSSFHSLHLLFEEYTNIPISLLFNEKEADDNDHEPQISPGGLEPPSEKHFRETEV tax1bp3-rtkn 567477 N/A 567482 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 567483 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction false false false 1 D tax1bp3-ctnnb1-3 567477 N/A 567484 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false c-terminal PDZ-recognition motif DTDL binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 567483 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction false false false 1 D, 2 B tax1bp3-tax 567477 N/A 567485 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro N/A 567483 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction false false false 1 D tax1bp3-ctnnb1-4 Mammalian two-hybrid assay indicates beta-catenin interacts with TIP-1 567478 N/A 567484 unspecified role unspecified role prey prey region tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 567483 unspecified role unspecified role bait bait gal4 dna bd tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false 2 A These results indicate the PDZ domain of TIP-1 is required for complex formation with beta-catenin and that the last 8 residues of TIP-1 may be involved in complex formation. tax1bp3-ctnnb1-5 Mammalian two-hybrid assay indicates beta-catenin interacts with TIP-1 567478 N/A 567483 unspecified role unspecified role bait bait gal4 dna bd tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 567484 unspecified role unspecified role prey prey region tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false c-terminal contains PDZ-recognition motif DTDL sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region Armadillo repeats 2-8 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false 2 D These results indicate that as well as the interaction between beta-catenin and TIP-1 involving the 4 C-terminal resicues of beta-catenin, in vivo the residues 173-483 containing Armadillo repeats 2-8 can also allow complex formation. tax1bp3-ctnnb1 Mammalian two-hybrid assay indicates beta-catenin interacts with TIP-1 567479 N/A 567484 unspecified role unspecified role prey prey region tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 567483 unspecified role unspecified role bait bait gal4 dna bd tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 1 A tax1bp3-ctnnb1-1 Immunoprecipitation indicate beta-catenin and TIP-1 interact 567480 N/A 567484 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 567483 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 1 B tax1bp3-ctnnb1-2 Immunofluorescence indicates beta-catenin and TIP-1 colocalize in the nucleus 567481 N/A 567484 unspecified role unspecified role neutral component neutral component region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 567483 unspecified role unspecified role neutral component neutral component region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false 1 C