IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ baas-2003-5 Activation of the tumour suppressor kinase LKB1 by the STE20-like pseudokinase STRAD. in vitro In vitro protein kinase assay protein kinase assay predetermined predetermined participant predetermined Baas AF., Boudeau J., Sapkota GP., Smit L., Medema R., Morrice NA., Alessi DR., Clevers HC. Apoptosis - Interactions involving proteins with a function related to apoptosis Source of LKB1 determined from previous work by the authors and mapping of mutants. clevers@niob.knaw.nl Foetal brain. EMBO J. (0261-4189) 2003 Only protein-protein interactions imex curation baas-2003-4 Activation of the tumour suppressor kinase LKB1 by the STE20-like pseudokinase STRAD. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Baas AF., Boudeau J., Sapkota GP., Smit L., Medema R., Morrice NA., Alessi DR., Clevers HC. Apoptosis - Interactions involving proteins with a function related to apoptosis Source of LKB1 determined from previous work by the authors and mapping of mutants. clevers@niob.knaw.nl Foetal brain. EMBO J. (0261-4189) 2003 Only protein-protein interactions imex curation baas-2003-1 Activation of the tumour suppressor kinase LKB1 by the STE20-like pseudokinase STRAD. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Baas AF., Boudeau J., Sapkota GP., Smit L., Medema R., Morrice NA., Alessi DR., Clevers HC. Apoptosis - Interactions involving proteins with a function related to apoptosis Source of LKB1 determined from previous work by the authors and mapping of mutants. clevers@niob.knaw.nl Foetal brain. EMBO J. (0261-4189) 2003 Only protein-protein interactions imex curation baas-2003-2 Activation of the tumour suppressor kinase LKB1 by the STE20-like pseudokinase STRAD. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Baas AF., Boudeau J., Sapkota GP., Smit L., Medema R., Morrice NA., Alessi DR., Clevers HC. Apoptosis - Interactions involving proteins with a function related to apoptosis Source of LKB1 determined from previous work by the authors and mapping of mutants. clevers@niob.knaw.nl Foetal brain. EMBO J. (0261-4189) 2003 Only protein-protein interactions imex curation baas-2003-3 Activation of the tumour suppressor kinase LKB1 by the STE20-like pseudokinase STRAD. rat-rat-2 Rat R2 embryo cells rat-2 Rat embryo cell line anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Baas AF., Boudeau J., Sapkota GP., Smit L., Medema R., Morrice NA., Alessi DR., Clevers HC. Apoptosis - Interactions involving proteins with a function related to apoptosis Source of LKB1 determined from previous work by the authors and mapping of mutants. clevers@niob.knaw.nl Foetal brain. EMBO J. (0261-4189) 2003 Only protein-protein interactions imex curation baas-2003-6 Activation of the tumour suppressor kinase LKB1 by the STE20-like pseudokinase STRAD. in vitro In vitro protein kinase assay protein kinase assay western blot western blot Immuno blot Immuno blot Baas AF., Boudeau J., Sapkota GP., Smit L., Medema R., Morrice NA., Alessi DR., Clevers HC. Apoptosis - Interactions involving proteins with a function related to apoptosis Antibodies to phospho-sites Thr336 and Thr363 in LKB1 were used to quantitate the reaction Source of LKB1 determined from previous work by the authors and mapping of mutants. clevers@niob.knaw.nl Foetal brain. EMBO J. (0261-4189) 2003 Only protein-protein interactions imex curation baas-2003-7 Activation of the tumour suppressor kinase LKB1 by the STE20-like pseudokinase STRAD. chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining Baas AF., Boudeau J., Sapkota GP., Smit L., Medema R., Morrice NA., Alessi DR., Clevers HC. Apoptosis - Interactions involving proteins with a function related to apoptosis Source of LKB1 determined from previous work by the authors and mapping of mutants. clevers@niob.knaw.nl Foetal brain. EMBO J. (0261-4189) 2003 Only protein-protein interactions imex curation stk11_human Serine/threonine-protein kinase STK11 STK11 LKB1 PJS Liver kinase B1 Renal carcinoma antigen NY-REN-19 protein protein human Homo sapiens Human MEVVDPQQLGMFTEGELMSVGMDTFIHRIDSTEVIYQPRRKRAKLIGKYLMGDLLGEGSYGKVKEVLDSETLCRRAVKILKKKKLRRIPNGEANVKKEIQLLRRLRHKNVIQLVDVLYNEEKQKMYMVMEYCVCGMQEMLDSVPEKRFPVCQAHGYFCQLIDGLEYLHSQGIVHKDIKPGNLLLTTGGTLKISDLGVAEALHPFAADDTCRTSQGSPAFQPPEIANGLDTFSGFKVDIWSAGVTLYNITTGLYPFEGDNIYKLFENIGKGSYAIPGDCGPPLSDLLKGMLEYEPAKRFSIRQIRQHSWFRKKHPPAEAPVPIPPSPDTKDRWRSMTVVPYLEDLHGADEDEDLFDIEDDIIYTQDFTVPGQVPEEEASHNGQRRGLPKAVCMNGTEAAQLSTKSRAEGRAPNPARKACSASSKIRRLSACKQQ straa_human STE20-related kinase adapter protein alpha STRADA Serologically defined breast cancer antigen NY-BR-96 STRAD LYK5 STE20-related adapter protein protein protein human Homo sapiens Human MSFLVSKPERIRRWVSEKFIVEGLRDLELFGEQPPGDTRRKTNDASSESIASFSKQEVMSSFLPEGGCYELLTVIGKGFEDLMTVNLARYKPTGEYVTVRRINLEACSNEMVTFLQGELHVSKLFNHPNIVPYRATFIADNELWVVTSFMAYGSAKDLICTHFMDGMNELAIAYILQGVLKALDYIHHMGYVHRSVKASHILISVDGKVYLSGLRSNLSMISHGQRQRVVHDFPKYSVKVLPWLSPEVLQQNLQGYDAKSDIYSVGITACELANGHVPFKDMPATQMLLEKLNGTVPCLLDTSTIPAEELTMSPSRSVANSGLSDSLTTSTPRPSNGDSPSHPYHRTFSPHFHHFVEQCLQRNPDARPSASTLLNHSFFKQIKRRASEALPELLRPVTPITNFEGSQSQDHSGIFGLVTNLEELEVDDWEF stk11_rat Serine/threonine-protein kinase STK11 Lkb1 Liver kinase B1 homolog Stk11 peptide peptide polypeptide oligopeptide oligopeptide polypeptide rat Rattus norvegicus (Rat) Rat MDVADPQPLGLFPEGELMSVGMDTFIHRIDSTEVIYQPRRKRAKLIGKYLMGDLLGEGSYGKVKEVLDSETLCRRAVKILKKKKLRRIPNGEANVKKEIQLLRRLRHRNVIQLVDVLYNEEKQKMYMVMEYCVCGMQEMLDSVPEKRFPVCQAHGYFRQLIDGLEYLHSQGIVHKDIKPGNLLLTTNGTLKISDLGVAEALHPFAVDDTCRTSQGSPAFQPPEIANGLDTFSGFKVDIWSAGVTLYNITTGLYPFEGDNIYKLFENIGRGDFTIPCDCAPPLSDLLRGMLEYEPAKRFSIRQIRQHSWFRKKHPLAEALVPIPPSPDTKDRWRSMTVVPYLEDLHGRAEEEEDEDLFDIEDGIIYTQDFTVPGQVLEEEVGQNGQSHSLPKAVCVNGTEPQLSSKVKPEGRPGAANPARKVCSSNKIRRLSACKQQ straa_rat STE20-related kinase adapter protein alpha Strada Strad Lyk5 STE20-related adapter protein protein protein rat Rattus norvegicus (Rat) Rat MSFLANEASSESIASFSKPEIMSSFLPEGGCYELLSVIGKGFEDLMTVNSRYKPTGEYVTVRRINLEACSNEMVTFLQGELHVSKLFSHPNIVPYRATFIADNELWAVTSFMAYGSAKDLIGTHFMDGMSELAIAYILQGVLKALDYIHHMGYVHRSVKASHILISTDGKVYLSGLRSNLSMISHGQRQRAVHDFPKYSIKVLPWLSPEVLQQNLQGYDAKSDIYSVGITACELANGHVPFKDMPATQMLLEKLNGTVPCLLDTSTIPAEELTMSPSRSIANPGLNDSLAAGSLRPANGDSPSHPYHRTFSPHFHNFVEQCLQRNPDARPNASTLLNHSFFKQIKRRASEALPELLRPVTPITSFEGSQSQDHSGILGLVTNLEDLEVDDWEF lkb1-1 Autophosphorylation of LKB1 545283 n/a 545290 putative self putative self putative self putative self region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. phosphorylation phosphorylation reaction phosphorylation false true false 3A & 3B Autophosphorylation of STK11 (Q15831). Subsequent mapping by mass spectrometry showed this to me at Thr-185 and Thr-402. lkb1-strad-7 Phosphorylation of STRAD by LKB1 545283 N/A 545291 enzyme target enzyme target substrate substrate unspecified role unspecified role region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. N/A 545290 enzyme enzyme unspecified role unspecified role region required to bind necessary binding region required to bind mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. phosphorylation phosphorylation reaction phosphorylation false false false 3A & 3B Phosphorylation of STARD (Q7RTN6). Subsequent mapping of phosphorylation sites by mass spectrometry (Fig. 6A) were shown to be Thr-329 and Thr-419. lkb1-strad-8 Phosphorylation of STRAD by LKB1 545283 N/A 545291 enzyme target enzyme target substrate substrate unspecified role unspecified role region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 545290 enzyme enzyme unspecified role unspecified role region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) phosphorylation phosphorylation reaction phosphorylation false false false 3D Phosphorylation of STRAD (Q7RTN6) lkb1-strad-4 Interaction between STRAD and LKB1 determined by coimmunoprecipitation 545284 N/A 545290 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false N/A 545291 unspecified role unspecified role prey prey physical association physical association false false false 2B & 2C stk11-strad-5 Interaction between STRAD and STK11 (LKB1) determined by coimmunoprecipitation 545284 N/A 545290 unspecified role unspecified role bait bait region required to bind necessary binding region required to bind mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 545291 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 3A lkb1-strad-1 Interaction between STRAD and LKB1 determined by yeast 2-hybrid. 545285 N/A 545290 unspecified role unspecified role bait bait N/A 545291 unspecified role unspecified role prey prey physical association physical association false false false Kinase dead (Asp176Tyr) STK11 (Q15831) used as bait. lkb1-strad-2 Interaction between STRAD and LKB1 determined by coimmunoprecipitation 545286 N/A 545290 unspecified role unspecified role bait bait N/A 545291 unspecified role unspecified role prey prey physical association physical association false false false 2A lkb1-strad-3 Interaction between rat STRAD and LKB1 determined by coimmunoprecipitation 545287 N/A 545292 unspecified role unspecified role bait bait N/A 545293 unspecified role unspecified role prey prey physical association physical association false false false 2A lkb1-2 Autophosphorylation of LKB1 545288 n/a 545290 putative self putative self putative self putative self region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. phosphorylation phosphorylation reaction phosphorylation false true false 4A STRAD (Q7RTN6) Autophosphorylation of STK11 (Q15381) stk11-strad-6 Interaction between STRAD and STK11 (LKB1) determined by coimmunoprecipitation 545289 N/A 545290 unspecified role unspecified role neutral component neutral component region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region required to bind necessary binding region required to bind mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false N/A 545291 unspecified role unspecified role neutral component neutral component region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false 3A