IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ garrard-2003-2 Structure of Cdc42 in a complex with the GTPase-binding domain of the cell polarity protein, Par6. canlf-mdck Canis familiaris (dog) kidney epithelial cells Canis lupus familiaris Dog Canis familiaris mdck Canine Cocker Spaniel kidney epithelial cell line anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Garrard SM., Capaldo CT., Gao L., Rosen MK., Macara IG., Tomchick DR. Apoptosis - Interactions involving proteins with a function related to apoptosis EMBO J. (0261-4189) 2003 garrard-2003-1 Structure of Cdc42 in a complex with the GTPase-binding domain of the cell polarity protein, Par6. in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Garrard SM., Capaldo CT., Gao L., Rosen MK., Macara IG., Tomchick DR. Apoptosis - Interactions involving proteins with a function related to apoptosis EMBO J. (0261-4189) 2003 garrard-2003-3 Structure of Cdc42 in a complex with the GTPase-binding domain of the cell polarity protein, Par6. in vitro In vitro fret fluorescent resonance energy transfer FRET RET FRET analysis FRET RET FRET analysis fret predetermined predetermined participant predetermined Garrard SM., Capaldo CT., Gao L., Rosen MK., Macara IG., Tomchick DR. Apoptosis - Interactions involving proteins with a function related to apoptosis EMBO J. (0261-4189) 2003 par6b_mouse Partitioning defective 6 homolog beta Pard6b Par6b protein protein mouse Mus musculus Mouse MNRGHRHGASSGCLGTMEVKSKFGAEFRRFSLERSKPGKFEEFYGLLQHVHKIPNVDVLVGYADIHGDLLPINNDDNYHKAVSTANPLLRIFIQKKEEADYSAFGTDTLIRKKNMLSNVLRPDNHRKKPHIVISMPQDFRPVSSIIDVDILPETHRRVRLYKYGTEKPLGFYIRDGSSVRVTPHGLEKVPGIFISRLVPGGLAQSTGLLAVNDEVLEVNGIEVSGKSLDQVTDMMIANSRNLIITVRPANQRNNVVRNSRTSGSSSQSTDNSLLGFPQQVEASFEPEDQDSDEDDIIIEDSGEPQQIPKATPAQSLESLTQIELSFESGQNGFSPPQDTSLVPVPGSLDTELESRAPDQKLLEEDGTIITL cdc42_human Cell division control protein 42 homolog CDC42 G25K GTP-binding protein protein protein human Homo sapiens Human MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPPEPKKSRRCVLL pak1_human Serine/threonine-protein kinase PAK 1 PAK1 p21-activated kinase 1 p65-PAK Alpha-PAK protein protein human Homo sapiens Human MSNNGLDIQDKPPAPPMRNTSTMIGAGSKDAGTLNHGSKPLPPNPEEKKKKDRFYRSILPGDKTNKKKEKERPEISLPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKSEQKKNPQAVLDVLEFYNSKKTSNSQKYMSFTDKSAEDYNSSNALNVKAVSETPAVPPVSEDEDDDDDDATPPPVIAPRPEHTKSVYTRSVIEPLPVTPTRDVATSPISPTENNTTPPDALTRNTEKQKKKPKMSDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTAMDVATGQEVAIKQMNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETCMDEGQIAAVCRECLQALEFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMIEGEPPYLNENPLRALYLIATNGTPELQNPEKLSAIFRDFLNRCLEMDVEKRGSAKELLQHQFLKIAKPLSSLTPLIAAAKEATKNNH cdc42-pard6b-5 CoIP : bait=Par6 , prey = cdc42 189030 N/A 189033 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 189034 unspecified role unspecified role prey prey P60953:p.Gly12Val mutation mutation certain certain sequence position certain certain certain sequence position certain false region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false P60953:p.Phe37Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false P60953:p.Tyr40Lys mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false P60953:p.Asp38Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) physical association physical association false false false G12V cdc42 is constitutively active form and can bind effectors the mutation D38A (in the mutant background G12V) has only a mild effect and par6 binding can still be detected cdc42-pak1-6 CoIP : bait=pak1 , prey = cdc42 189030 N/A 189034 unspecified role unspecified role prey prey region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false P60953:p.Asp38Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false P60953:p.Gly12Val mutation mutation certain certain sequence position certain certain certain sequence position certain false P60953:p.Tyr40Lys mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 189035 unspecified role unspecified role bait bait crib binding region binding-associated region binding region range range range range false physical association physical association false false false G12V cdc42 is constitutively active form and can bind effectors cdc42-pard6b-4 X-Ray : crystal of cdc42 with Par6 189031 N/A 189033 unspecified role unspecified role neutral component neutral component crib-pdz domains binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 189034 unspecified role unspecified role neutral component neutral component P60953:p.Glu62Leu mutation mutation certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false working 21.9%, free 27.3% 2.10A Q61L cdc42 is constitutively active form and can bind effectors cdc42-pard6b-6 FRET : interaction between cdc42 with Par6 189032 N/A 189034 unspecified role unspecified role neutral component neutral component P60953:p.Gln61Leu mutation mutation certain certain sequence position certain certain certain sequence position certain false P60953:p.Asp38Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false P60953:p.Tyr40Lys mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 189033 unspecified role unspecified role neutral component neutral component crib-pdz domains binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false cfp tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false yfp tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false Q61L cdc42 is constitutively active form and can bind effectors D38A mutation on cdc42 had a milder effect than Y40K on the interaction