IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ lake-2003-1 The role of Vif during HIV-1 infection: interaction with novel host cellular factors. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Lake JA., Carr J., Feng F., Mundy L., Burrell C., Li P. Apoptosis - Interactions involving proteins with a function related to apoptosis Matchmaker yeast Two-hybrid system 3 was used. fig 2 jill.carr@imvs.sa.gov.au Human leucocyte cDNA library screened. J. Clin. Virol. (1386-6532) 2003 vif_hv1n5 Virion infectivity factor SOR protein vif protein protein hv1n5 Human immunodeficiency virus type 1 group M subtype B (isolate NY5) (HIV-1) HIV-1 MENRWQVMIVWQVDRMRINTWKRLVKHHMYISRKAKDWFYRHHYESTNPKISSEVHIPLGDAKLVITTYWGLHTGERDWHLGQGVSIEWRKKRYSTQVDPDLADQLIHLHYFDCFSESAIRNTILGRIVSPRCEYQAGHNKVGSLQYLALAALIKPKQIKPPLPSVRKLTEDRWNKPQKTKGHRGSHTMNGH q9nwf9-3 E3 ubiquitin-protein ligase RNF216 RNF216 TRIAD3 UBCE7IP1 ZIN RING finger protein 216 Triad domain-containing protein 3 Ubiquitin-conjugating enzyme 7-interacting protein 1 Zinc finger protein inhibiting NF-kappa-B ZIN TRIAD3 RING-type E3 ubiquitin transferase RNF216 protein protein human Homo sapiens Human MADFKVLSSQDIKWALHELKGHYAITRKALSDAIKKWQELSPETSGKRKKRKQMNQYSYIDFKFEQGDIKIEKRMFFLENKRRHCRSYDRRALLPAVQQEQEFYEQKIKEMAEHEDFLLALQMNEEQYQKDGQLIECRCCYGEFPFEELTQCADAHLFCKECLIRYAQEAVFGSGKLELSCMEGSCTCSFPTSELEKVLPQTILYKYYERKAEEEVAAAYADELVRCPSCSFPALLDSDVKRFSCPNPHCRKETCRKCQGLWKEHNGLTCEELAEKDDIKYRTSIEEKMTAARIRKCHKCGTGLIKSEGCNRMSCRCGAQMCYLCRVSINGYDHFCQHPRSPGAPCQECSRCSLWTDPTEDDEKLIEEIQKEAEEEQKRKNGENTFKRIGPPLEKPVEKVQRVEALPRPVPQNLPQPQMPPYAFAHPPFPLPPVRPVFNNFPLNMGPIPAPYVPPLPNVRVNYDFGPIHMPLEHNLPMHFGPQPRHRF 4 different alternatively spliced mRNAs code for this protein isoform. sat1_human Diamine acetyltransferase 1 SAT1 Spermidine/spermine N(1)-acetyltransferase 1 Putrescine acetyltransferase Polyamine N-acetyltransferase 1 SAT protein protein human Homo sapiens Human MAKFVIRPATAADCSDILRLIKELAKYEYMEEQVILTEKDLLEDGFGEHPFYHCLVAEVPKEHWTPEGHSIVGFAMYYFTYDPWIGKLLYLEDFFVMSDYRGFGIGSEILKNLSQVAMRCRCSSMHFLVAEWNEPSINFYKRRGASDLSSEEGWRLFKIDKEYLLKMATEE ubce7ip1-vif-4 Y2H: bait= HIV-1 vif, prey= Human ZIN (TRIAD3) 296920 N/A 296921 unspecified role unspecified role bait bait P12504:p.Gln105_Ile107delinsAlaAlaAla gln105ala&leu106ala&ile107ala mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false N/A 296922 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false HIV-1 pNL4.3 corresponding to HIV M19921 (HV1N5) was used to amplify vif. sat-vif-1 Y2H: bait= HIV-1 vif, prey= Human SSAT 296920 N/A 296923 unspecified role unspecified role prey prey N/A 296921 unspecified role unspecified role bait bait ephfo Ephedra foeminea physical association physical association false false false HIV-1 pNL4.3 corresponding to HIV M19921 (HV1N5) was used to amplify vif.