IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ wilson-2002-1 The DIAP1 RING finger mediates ubiquitination of Dronc and is indispensable for regulating apoptosis. drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. tap tandem affinity purification TAP TAP tap western blot western blot Immuno blot Immuno blot Wilson R., Goyal L., Ditzel M., Zachariou A., Baker DA., Agapite J., Steller H., Meier P. Apoptosis - Interactions involving proteins with a function related to apoptosis Nat. Cell Biol. (1465-7392) 2002 wilson-2002-2 The DIAP1 RING finger mediates ubiquitination of Dronc and is indispensable for regulating apoptosis. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. coip coimmunoprecipitation co-immunoprecipitation CoIp immunoprecipitation Co-IP co-immunoprecipitation CoIp immunoprecipitation Co-IP coip western blot western blot Immuno blot Immuno blot Wilson R., Goyal L., Ditzel M., Zachariou A., Baker DA., Agapite J., Steller H., Meier P. Apoptosis - Interactions involving proteins with a function related to apoptosis Ubiquitination of proteins was detected by immunoblotting with an anti HA antibody to detect the presence of HA-ubiquitin. Nat. Cell Biol. (1465-7392) 2002 rpr_drome Cell death protein rpr Protein reaper rpr CG4319 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MAVAFYIPDQATLLREAEQKEQQILRLRESQWRFLATVVLETLRQYTSCHPKTGRKSGKYRKPSQ diap1_drome Death-associated inhibitor of apoptosis 1 Diap1 Apoptosis 1 inhibitor E3 ubiquitin-protein ligase th Iap1 Inhibitor of apoptosis 1 Protein thread th CG12284 RING-type E3 ubiquitin transferase Diap1 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MASVVADLPSYGPIAFDQVDNNTNATQLFKNNINKTRMNDLNREETRLKTFTDWPLDWLDKRQLAQTGMYFTHAGDKVKCFFCGVEIGCWEQEDQPVPEHQRWSPNCPLLRRRTTNNVPINAEALDRILPPISYDICGANDSTLEMREHAYAEGVIPMSQLIQSIGMNAVNAAGSVTGTAAPQPRVTVATHASTATQATGDVQPETCRPSAASGNYFPQYPEYAIETARLRTFEAWPRNLKQKPHQLAEAGFFYTGVGDRVRCFSCGGGLMDWNDNDEPWEQHALWLSQCRFVKLMKGQLYIDTVAAKPVLAEEKEESSSIGGVAVASTQASEEEQQTSLSSEEAVSGDVAPSVAPTAATRIFNKIVEATAVATPSTNSSGSTSIPEEKLCKICYGAEYNTAFLPCGHVVACAKCASSVTKCPLCRKPFTDVMRVYFS hid_drome Cell death protein hid hid Protein head involution defective Protein wrinkled W CG5123 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MAVPFYLPEGGADDVASSSSGASGNSSPHNHPLPSSASSSVSSSGVSSASASSASSSSSASSDGASSAASQSPNTTTSSATQTPMQSPLPTDQVLYALYEWVRMYQSQQSAPQIFQYPPPSPSCNFTGGDVFFPHGHPNPNSNPHPRTPRTSVSFSSGEEYNFFRQQQPQPHPSYPAPSTPQPMPPQSAPPMHCSHSYPQQSAHMMPHHSAPFGMGGTYYAGYTPPPTPNTASAGTSSSSAAFGWHGHPHSPFTSTSTPLSAPVAPKMRLQRSQSDAARRKRLTSTGEDEREYQSDHEATWDEFGDRYDNFTAGRERLQEFNGRIPPRKKKSSNSHSSSSNNPVCHTDSQPGGTSQAESGAIHGHISQQRQVERERQKAKAEKKKPQSFTWPTVVTVFVLAMGCGFFAAR dronc_drome Caspase Dronc Dronc NEDD2-like caspase Nc CG8091 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MQPPELEIGMPKRHREHIRKNLNILVEWTNYERLAMECVQQGILTVQMLRNTQDLNGKPFNMDEKDVRVEQHRRLLLKITQRGPTAYNLLINALRNINCLDAAVLLESVDESDSRPPFISLNERRTSRKSADIVDTPSPEASEGPCVSKLRNEPLGALTPYVGVVDGPEVKKSKKIHGGDSAILGTYKMQSRFNRGVLLMVNIMDYPDQNRRRIGAEKDSKSLIHLFQELNFTIFPYGNVNQDQFFKLLTMVTSSSYVQNTECFVMVLMTHGNSVEGKEKVEFCDGSVVDMQKIKDHFQTAKCPYLVNKPKVLMFPFCRGDEYDLGHPKNQGNLMEPVYTAQEEKWPDTQTEGIPSPSTNVPSLADTLVCYANTPGYVTHRDLDTGSWYIQKFCQVMADHAHDTDLEDILKKTSEAVGNKRTKKGSMQTGAYDNLGFNKKLYFNPGFFNE diap1-rpr The DIAP1 protein interacts with the Rpr protein 171519 N/A 171521 unspecified role unspecified role prey prey c terminal tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 171522 unspecified role unspecified role bait bait c -teminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false It was demonstarted that neither the DIAP1 first BIR domain (BIR1) or RING finger domain were required for binding to Rpr protein. diap1-hid The DIAP1 protein inteacts with the Hid protein 171519 N/A 171522 unspecified role unspecified role bait bait c-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 171523 unspecified role unspecified role prey prey c-terminal v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false It was demonstrated that neither the first BIR domain (BIR1) or the RING finger domain of the DIAP1 protein was required for binding for the Hid protein diap1-dronc The DIAP1 protein interacts with the Dronc protein 171519 N/A 171524 unspecified role unspecified role prey prey c-terminal v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false Q9XYF4:p.Cys318Ala catalytically inactive mutant mutation mutation certain certain sequence position certain certain certain sequence position certain false N/A 171522 unspecified role unspecified role bait bait c-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false A catalytically inactive Dronc mutant (Dronc Cys318Ala) was used in this study diap1h283y-dronc The mutant DIAP1 H283Y protein shows diminished binding activity to the Dronc protein 171519 N/A 171524 unspecified role unspecified role prey prey c-terminal v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false Q9XYF4:p.Cys318Ala Catalytically inactive mutant mutation mutation certain certain sequence position certain certain certain sequence position certain false N/A 171522 unspecified role unspecified role bait bait c-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false Q24306:p.His283Tyr Reduced binding affinity mutation mutation certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false diap1-dronc-1 The DIAP1 protein mediates ubiquitination of the Dronc protein 171520 N/A 171522 unspecified role unspecified role prey prey undefined mutation Fails to promote ubiquitination of Dronc mutation mutation certain certain sequence position certain certain certain sequence position certain false c-terminal myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false undefined mutation Fails to promote ubiquitination of Dronc mutation mutation certain certain sequence position certain certain certain sequence position certain false N/A 171522 unspecified role unspecified role prey prey c-terminal myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false undefined mutation Fails to promote ubiquitination of Dronc mutation mutation certain certain sequence position certain certain certain sequence position certain false N/A 171522 unspecified role unspecified role prey prey c-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 171524 unspecified role unspecified role bait bait c-terminal myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false full-length Wild type DIAP1 mediates ubiquitination of Dronc binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ubiquitination ubiquitination reaction ubiquitination false false false DIAP1 mediated ubiquitination of Dronc requires binding of DIAP1 to Dronc and a functional DIAP1 RING finger domain A catalytically inactive Dronc mutant (Dronc C>A) was used in this study