IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ breckenridg-2002-1 The procaspase-8 isoform, procaspase-8L, recruited to the BAP31 complex at the endoplasmic reticulum. human-epithelium Homo sapiens epithelium/epithelial cells epithelium Epithelium [epithelial cells] coip coimmunoprecipitation co-immunoprecipitation CoIp immunoprecipitation Co-IP co-immunoprecipitation CoIp immunoprecipitation Co-IP coip western blot western blot Immuno blot Immuno blot Breckenridge DG., Nguyen M., Kuppig S., Reth M., Shore GC. Apoptosis - Interactions involving proteins with a function related to apoptosis Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2002 q14790-9 Caspase-8 CASP8 MCH5 Apoptotic cysteine protease Apoptotic protease Mch-5 CAP4 FADD-homologous ICE/ced-3-like protease FADD-like ICE ICE-like apoptotic protease 5 MORT1-associated ced-3 homolog 8L protein protein human Homo sapiens Human MEGGRRARVVIESKRNFFLGAFPTPFPAEHVELGRLGDSETAMVPGKGGADYILLPFKKMDFSRNLYDIGEQLDSEDLASLKFLSLDYIPQRKQEPIKDALMLFQRLQEKRMLEESNLSFLKELLFRINRLDLLITYLNTRKEEMERELQTPGRAQISAYRVMLYQISEEVSRSELRSFKFLLQEEISKCKLDDDMNLLDIFIEMEKRVILGEGKLDILKRVCAQINKSLLKIINDYEEFSKERSSSLEGSPDEFSNGEELCGVMTISDSPREQDSESQTLDKVYQMKSKPRGYCLIINNHNFAKAREKVPKLHSIRDRNGTHLDAGALTTTFEELHFEIKPHDDCTVEQIYEILKIYQLMDHSNMDCFICCILSHGDKGIIYGTDGQEAPIYELTSQFTGLKCPSLAGKPKVFFIQACQGDNYQKGIPVETDSEEQPYLEMDLSSPQTRYIPDEADFLLGMATVNNCVSYRNPAEGTWYIQSLCQSLRERCPRGDDILTILTEVNYEVSNKDDKKNMGKQMPQPTFTLRKKLVFPSD Ref.8 (AAL87628) sequence is in conflict in position: 14:K->R. bap31_human B-cell receptor-associated protein 31 BCAP31 BAP31 p28 6C6-AG tumor-associated antigen DXS1357E Protein CDM protein protein human Homo sapiens Human MSLQWTAVATFLYAEVFVVLLLCIPFISPKRWQKIFKSRLVELLVSYGNTFFVVLIVILVLLVIDAVREIRKYDDVTEKVNLQNNPGAMEHFHMKLFRAQRNLYIAGFSLLLSFLLRRLVTLISQQATLLASNEAFKKQAESASEAAKKYMEENDQLKKGAAVDGGKLDVGNAEVKLEEENRSLKADLQKLKDELASTKQKLEKAENQVLAMRKQSEGLTKEYDRLLEEHAKLQAAVDGPMDKKEE bcap31-casp8 Interaction of p28Bap31 and Caspase-8 demonstrated by co-immunoprecipitation 15925 N/A 15926 unspecified role unspecified role prey prey N/A 15927 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false P51572:p.Asp155Ala mutation mutation certain certain sequence position certain certain certain sequence position certain false P51572:p.Asp238Ala mutation mutation certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Asp -> Ala mutations result in caspase-resistant mutant. 62kDa Caspase-8 isoform (isoform 9) interacts with p28Bap31, the 53 and 55kDa isoforms do not. There are 4 isoforms corresponding to each molecular weight - since the immunoblot cannot be mapped to a specific isoform, the negative inteactions have not been entered