IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ metkar-2002-1 Cytotoxic cell granule-mediated apoptosis: perforin delivers granzyme B-serglycin complexes into target cells without plasma membrane pore formation. human-yt Homo sapiens yt Human T/NK cell leukemia anti bait coip anti bait coimmunoprecipitation anti bait coip weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Metkar SS., Wang B., Aguilar-Santelises M., Raja SM., Uhlin-Hansen L., Podack E., Trapani JA., Froelich CJ. Apoptosis - Interactions involving proteins with a function related to apoptosis Identity of Serglycin was determined by sensitivity to chondroitinase ABC and resistance to heparinase/heparitinase digestion plus comparison to the mobility of isolated SG by SDS-PAGE and silver stain c-froelich@northwestern.edu Immunity (1074-7613) 2002 Only protein-protein interactions imex curation metkar-2002-2 Cytotoxic cell granule-mediated apoptosis: perforin delivers granzyme B-serglycin complexes into target cells without plasma membrane pore formation. human-yt Homo sapiens yt Human T/NK cell leukemia anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Metkar SS., Wang B., Aguilar-Santelises M., Raja SM., Uhlin-Hansen L., Podack E., Trapani JA., Froelich CJ. Apoptosis - Interactions involving proteins with a function related to apoptosis Identity of Serglycin was determined by sensitivity to chondroitinase ABC and resistance to heparinase/heparitinase digestion plus comparison to the mobility of isolated SG by SDS-PAGE and silver stain c-froelich@northwestern.edu Immunity (1074-7613) 2002 Only protein-protein interactions imex curation metkar-2002-3 Cytotoxic cell granule-mediated apoptosis: perforin delivers granzyme B-serglycin complexes into target cells without plasma membrane pore formation. human-yt Homo sapiens yt Human T/NK cell leukemia anti bait coip anti bait coimmunoprecipitation anti bait coip elisa enzyme linked immunosorbent assay ELISA ELISA elisa Metkar SS., Wang B., Aguilar-Santelises M., Raja SM., Uhlin-Hansen L., Podack E., Trapani JA., Froelich CJ. Apoptosis - Interactions involving proteins with a function related to apoptosis Identity of Serglycin was determined by sensitivity to chondroitinase ABC and resistance to heparinase/heparitinase digestion plus comparison to the mobility of isolated SG by SDS-PAGE and silver stain c-froelich@northwestern.edu Immunity (1074-7613) 2002 Only protein-protein interactions imex curation metkar-2002-4 Cytotoxic cell granule-mediated apoptosis: perforin delivers granzyme B-serglycin complexes into target cells without plasma membrane pore formation. in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column western blot western blot Immuno blot Immuno blot Metkar SS., Wang B., Aguilar-Santelises M., Raja SM., Uhlin-Hansen L., Podack E., Trapani JA., Froelich CJ. Apoptosis - Interactions involving proteins with a function related to apoptosis Identity of Serglycin was determined by sensitivity to chondroitinase ABC and resistance to heparinase/heparitinase digestion plus comparison to the mobility of isolated SG by SDS-PAGE and silver stain c-froelich@northwestern.edu Immunity (1074-7613) 2002 Only protein-protein interactions imex curation perf_human Perforin-1 Lymphocyte pore-forming protein Cytolysin PRF1 PFP protein protein human Homo sapiens Human MAARLLLLGILLLLLPLPVPAPCHTAARSECKRSHKFVPGAWLAGEGVDVTSLRRSGSFPVDTQRFLRPDGTCTLCENALQEGTLQRLPLALTNWRAQGSGCQRHVTRAKVSSTEAVARDAARSIRNDWKVGLDVTPKPTSNVHVSVAGSHSQAANFAAQKTHQDQYSFSTDTVECRFYSFHVVHTPPLHPDFKRALGDLPHHFNASTQPAYLRLISNYGTHFIRAVELGGRISALTALRTCELALEGLTDNEVEDCLTVEAQVNIGIHGSISAEAKACEEKKKKHKMTASFHQTYRERHSEVVGGHHTSINDLLFGIQAGPEQYSAWVNSLPGSPGLVDYTLEPLHVLLDSQDPRREALRRALSQYLTDRARWRDCSRPCPPGRQKSPRDPCQCVCHGSAVTTQDCCPRQRGLAQLEVTFIQAWGLWGDWFTATDAYVKLFFGGQELRTSTVWDNNNPIWSVRLDFGDVLLATGGPLRLQVWDQDSGRDDDLLGTCDQAPKSGSHEVRCNLNHGHLKFRYHARCLPHLGGGTCLDYVPQMLLGEPPGNRSGAVW srgn_human Serglycin Secretory granule proteoglycan core protein Platelet proteoglycan core protein SRGN PRG PRG1 Hematopoietic proteoglycan core protein protein protein human Homo sapiens Human MMQKLLKCSRLVLALALILVLESSVQGYPTRRARYQWVRCNPDSNSANCLEEKGPMFELLPGESNKIPRLRTDLFPKTRIQDLNRIFPLSEDYSGSGFGSGSGSGSGSGSGFLTEMEQDYQLVDESDAFHDNLRSLDRNLPSDSQDLGQHGLEEDFML grab_human Granzyme B GZMB CGL1 CSPB CTLA1 GRB Granzyme-2 T-cell serine protease 1-3E Cytotoxic T-lymphocyte proteinase 2 SECT Cathepsin G-like 1 CTLA-1 Fragmentin-2 Human lymphocyte protein C11 protein protein human Homo sapiens Human MQPILLLLAFLLLPRADAGEIIGGHEAKPHSRPYMAYLMIWDQKSLKRCGGFLIRDDFVLTAAHCWGSSINVTLGAHNIKEQEPTQQFIPVKRPIPHPAYNPKNFSNDIMLLQLERKAKRTRAVQPLRLPSNKAQVKPGQTCSVAGWGQTAPLGKHSHTLQEVKMTVQEDRKCESDLRHYYDSTIELCVGDPEIKKTSFKGDSGGPLVCNKVAQGIVSYGRNNGMPPRACTKVSSFVHWIKKTMKRY perf-srgn Perforin-Serglycin 866888 n/a 866892 unspecified role unspecified role bait bait region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 866893 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 2A grab-srgn-1 866888 n/a 866893 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 866894 unspecified role unspecified role bait bait region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 2A perf-grab 866889 n/a 866894 unspecified role unspecified role bait bait 35s 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 866892 unspecified role unspecified role bait bait region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 2B. grab-perf 866889 n/a 866894 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 866892 unspecified role unspecified role bait bait region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 2C. perf-grab-1 866890 n/a 866892 unspecified role unspecified role bait bait region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 866894 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false This perf-grab complex was shown to bind to sulfated proteoglycans or glycosaminoglycans in a Biocolor Ltd. Blyscan assay, which the authors present as evidence for binding to SRGN. Fig. 2D. grab-srgn-2 866891 n/a 866894 unspecified role unspecified role neutral component neutral component human-t-cell Homo sapiens t-cell Peripheral blood T-lymphocytes n/a 866893 unspecified role unspecified role neutral component neutral component human-thp-1 Homo sapiens acute monocytic leukemia cells thp-1 Human acute monocytic leukemia cell line Human acute monocytic leukemia established from the peripheral blood of a 1-year-old boy with acute monocytic leukemia (AML) at relapse in 1978. physical association physical association false false false Fig. 4B