IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ christich-2002-1 The damage-responsive Drosophila gene sickle encodes a novel IAP binding protein similar to but distinct from reaper, grim, and hid. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Christich A., Kauppila S., Chen P., Sogame N., Ho SI., Abrams JM. Apoptosis - Interactions involving proteins with a function related to apoptosis Curr. Biol. (0960-9822) 2002 q9vvp8_drome skl Skl Dmel\CG13701 meph veto Dmel_CG13701 BcDNA:RE14076 CG13701 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MAIPFFEEEHAPKSEPSGDQVDSPMAFSIDPGHDQVDFEGPPSAAEELPPPGATSEPVAPPSAEEQLLAWKFLAITMCKVLKQFYQQHKSSGKSSKLKATVQIQPQAQ diap1_drome Death-associated inhibitor of apoptosis 1 Diap1 Apoptosis 1 inhibitor E3 ubiquitin-protein ligase th Iap1 Inhibitor of apoptosis 1 Protein thread th CG12284 RING-type E3 ubiquitin transferase Diap1 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MASVVADLPSYGPIAFDQVDNNTNATQLFKNNINKTRMNDLNREETRLKTFTDWPLDWLDKRQLAQTGMYFTHAGDKVKCFFCGVEIGCWEQEDQPVPEHQRWSPNCPLLRRRTTNNVPINAEALDRILPPISYDICGANDSTLEMREHAYAEGVIPMSQLIQSIGMNAVNAAGSVTGTAAPQPRVTVATHASTATQATGDVQPETCRPSAASGNYFPQYPEYAIETARLRTFEAWPRNLKQKPHQLAEAGFFYTGVGDRVRCFSCGGGLMDWNDNDEPWEQHALWLSQCRFVKLMKGQLYIDTVAAKPVLAEEKEESSSIGGVAVASTQASEEEQQTSLSSEEAVSGDVAPSVAPTAATRIFNKIVEATAVATPSTNSSGSTSIPEEKLCKICYGAEYNTAFLPCGHVVACAKCASSVTKCPLCRKPFTDVMRVYFS rpr_drome Cell death protein rpr Protein reaper rpr CG4319 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MAVAFYIPDQATLLREAEQKEQQILRLRESQWRFLATVVLETLRQYTSCHPKTGRKSGKYRKPSQ diap1_bir2-ski The sickle protein interacts with the BIR2 domain of the DIAP1 protein 172911 N/A 172912 unspecified role unspecified role prey prey region GFP tagged protein tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. N/A 172913 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region DIAP1 BIR2 domain binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false diap1-rpr-2 The Rpr protein interacts with the BIR2 domain of the DIAP1 protein 172911 N/A 172914 unspecified role unspecified role prey prey region GFP tagged protein tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. N/A 172913 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region BIR2 domain binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false