IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ vucic-2002-1 SMAC negatively regulates the anti-apoptotic activity of melanoma inhibitor of apoptosis (ML-IAP). in vitro In vitro pull down pull down predetermined predetermined participant predetermined Vucic D., Deshayes K., Ackerly H., Pisabarro MT., Kadkhodayan S., Fairbrother WJ., Dixit VM. Apoptosis - Interactions involving proteins with a function related to apoptosis Biotin-linked synthetic peptides were mixed with potential preys and pulled down using streptavidin beads. The pulled down interactors were detected by silver staining SDS PAGE. J. Biol. Chem. (0021-9258) 2002 Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Parkinsons - Interactions investigated in the context of Parkinsons disease vucic-2002-3 SMAC negatively regulates the anti-apoptotic activity of melanoma inhibitor of apoptosis (ML-IAP). in vitro In vitro fps fluorescence polarization spectroscopy Fluorescence anisotropy FPS FPS Fluorescence anisotropy fps predetermined predetermined participant predetermined Vucic D., Deshayes K., Ackerly H., Pisabarro MT., Kadkhodayan S., Fairbrother WJ., Dixit VM. Apoptosis - Interactions involving proteins with a function related to apoptosis Biotin-linked synthetic peptides were mixed with potential preys and pulled down using streptavidin beads. The pulled down interactors were detected by silver staining SDS PAGE. J. Biol. Chem. (0021-9258) 2002 Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Parkinsons - Interactions investigated in the context of Parkinsons disease vucic-2002-2 SMAC negatively regulates the anti-apoptotic activity of melanoma inhibitor of apoptosis (ML-IAP). human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Vucic D., Deshayes K., Ackerly H., Pisabarro MT., Kadkhodayan S., Fairbrother WJ., Dixit VM. Apoptosis - Interactions involving proteins with a function related to apoptosis Biotin-linked synthetic peptides were mixed with potential preys and pulled down using streptavidin beads. The pulled down interactors were detected by silver staining SDS PAGE. J. Biol. Chem. (0021-9258) 2002 Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Parkinsons - Interactions investigated in the context of Parkinsons disease vucic-2002-4 SMAC negatively regulates the anti-apoptotic activity of melanoma inhibitor of apoptosis (ML-IAP). in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Vucic D., Deshayes K., Ackerly H., Pisabarro MT., Kadkhodayan S., Fairbrother WJ., Dixit VM. Apoptosis - Interactions involving proteins with a function related to apoptosis Biotin-linked synthetic peptides were mixed with potential preys and pulled down using streptavidin beads. The pulled down interactors were detected by silver staining SDS PAGE. J. Biol. Chem. (0021-9258) 2002 Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Parkinsons - Interactions investigated in the context of Parkinsons disease vucic-2002-5 SMAC negatively regulates the anti-apoptotic activity of melanoma inhibitor of apoptosis (ML-IAP). human-mcf7 Homo sapiens mammary carcinoma cells mcf7 mammary carcinoma cells anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Vucic D., Deshayes K., Ackerly H., Pisabarro MT., Kadkhodayan S., Fairbrother WJ., Dixit VM. Apoptosis - Interactions involving proteins with a function related to apoptosis Biotin-linked synthetic peptides were mixed with potential preys and pulled down using streptavidin beads. The pulled down interactors were detected by silver staining SDS PAGE. J. Biol. Chem. (0021-9258) 2002 Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Parkinsons - Interactions investigated in the context of Parkinsons disease casp9_human Caspase-9 ICE-like apoptotic protease 6 Apoptotic protease Mch-6 Apoptotic protease-activating factor 3 CASP9 MCH6 protein protein human Homo sapiens Human MDEADRRLLRRCRLRLVEELQVDQLWDALLSRELFRPHMIEDIQRAGSGSRRDQARQLIIDLETRGSQALPLFISCLEDTGQDMLASFLRTNRQAAKLSKPTLENLTPVVLRPEIRKPEVLRPETPRPVDIGSGGFGDVGALESLRGNADLAYILSMEPCGHCLIINNVNFCRESGLRTRTGSNIDCEKLRRRFSSLHFMVEVKGDLTAKKMVLALLELAQQDHGALDCCVVVILSHGCQASHLQFPGAVYGTDGCPVSVEKIVNIFNGTSCPSLGGKPKLFFIQACGGEQKDHGFEVASTSPEDESPGSNPEPDATPFQEGLRTFDQLDAISSLPTPSDIFVSYSTFPGFVSWRDPKSGSWYVETLDDIFEQWAHSEDLQSLLLRVANAVSVKGIYKQMPGCFNFLRKKLFFKTS birc7_human Baculoviral IAP repeat-containing protein 7 Kidney inhibitor of apoptosis protein Melanoma inhibitor of apoptosis protein Livin RING finger protein 50 UNQ5800/PRO19607/PRO21344 BIRC7 KIAP LIVIN MLIAP RNF50 RING-type E3 ubiquitin transferase BIRC7 protein protein human Homo sapiens Human MGPKDSAKCLHRGPQPSHWAAGDGPTQERCGPRSLGSPVLGLDTCRAWDHVDGQILGQLRPLTEEEEEEGAGATLSRGPAFPGMGSEELRLASFYDWPLTAEVPPELLAAAGFFHTGHQDKVRCFFCYGGLQSWKRGDDPWTEHAKWFPSCQFLLRSKGRDFVHSVQETHSQLLGSWDPWEEPEDAAPVAPSVPASGYPELPTPRREVQSESAQEPGGVSPAEAQRAWWVLEPPGARDVEAQLRRLQEERTCKVCLDRAVSIVFVPCGHLVCAECAPGLQLCPICRAPVRSRVRTFLS dbloh_human Diablo homolog, mitochondrial Second mitochondria-derived activator of caspase Direct IAP-binding protein with low pI DIABLO SMAC protein protein human Homo sapiens Human MAALKSWLSRSVTSFFRYRQCLCVPVVANFKKRCFSELIRPWHKTVTIGFGVTLCAVPIAQKSEPHSLSSEALMRRAVSLVTDSTSTFLSQTTYALIEAITEYTKAVYTLTSLYRQYTSLLGKMNSEEEDEVWQVIIGARAEMTSKHQEYLKLETTWMTAVGLSEMAAEAAYQTGADQASITARNHIQLVKLQVEEVHQLSRKAETKLAEAQIEELRQKTQEEGEERAESEQEAYLRED htra2_human Serine protease HTRA2, mitochondrial High temperature requirement protein A2 Omi stress-regulated endoprotease Serine proteinase OMI Serine protease 25 HTRA2 PRSS25 OMI protein protein human Homo sapiens Human MAAPRAGRGAGWSLRAWRALGGIRWGRRPRLTPDLRALLTSGTSDPRARVTYGTPSLWARLSVGVTEPRACLTSGTPGPRAQLTAVTPDTRTREASENSGTRSRAWLAVALGAGGAVLLLLWGGGRGPPAVLAAVPSPPPASPRSQYNFIADVVEKTAPAVVYIEILDRHPFLGREVPISNGSGFVVAADGLIVTNAHVVADRRRVRVRLLSGDTYEAVVTAVDPVADIATLRIQTKEPLPTLPLGRSADVRQGEFVVAMGSPFALQNTITSGIVSSAQRPARDLGLPQTNVEYIQTDAAIDFGNSGGPLVNLDGEVIGVNTMKVTAGISFAIPSDRLREFLHRGEKKNSSSGISGSQRRYIGVMMLTLSPSILAELQLREPSFPDVQHGVLIHKVILGSPAHRAGLRPGDVILAIGEQMVQNAEDVYEAVRTQSQLAVQIRRGRETLTLYVTPEVTE xiap_human E3 ubiquitin-protein ligase XIAP Inhibitor of apoptosis protein 3 X-linked inhibitor of apoptosis protein IAP-like protein XIAP API3 IAP3 BIRC4 Baculoviral IAP repeat-containing protein 4 RING-type E3 ubiquitin transferase XIAP protein protein human Homo sapiens Human MTFNSFEGSKTCVPADINKEEEFVEEFNRLKTFANFPSGSPVSASTLARAGFLYTGEGDTVRCFSCHAAVDRWQYGDSAVGRHRKVSPNCRFINGFYLENSATQSTNSGIQNGQYKVENYLGSRDHFALDRPSETHADYLLRTGQVVDISDTIYPRNPAMYSEEARLKSFQNWPDYAHLTPRELASAGLYYTGIGDQVQCFCCGGKLKNWEPCDRAWSEHRRHFPNCFFVLGRNLNIRSESDAVSSDRNFPNSTNLPRNPSMADYEARIFTFGTWIYSVNKEQLARAGFYALGEGDKVKCFHCGGGLTDWKPSEDPWEQHAKWYPGCKYLLEQKGQEYINNIHLTHSLEECLVRTTEKTPSLTRRIDDTIFQNPMVQEAIRMGFSFKDIKKIMEEKIQISGSNYKSLEVLVADLVNAQKDSMQDESSQTSLQKEISTEEQLRRLQEEKLCKICMDRNIAIVFVPCGHLVTCKQCAEAVDKCPMCYTVITFKQKIFMS birc7-casp9-2 pull-down: biotinylated peptide = caspase 9, prey = ML-IAP BIR domain 174828 N/A 174833 unspecified role unspecified role bait bait biotin tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false peptide binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 174834 unspecified role unspecified role prey prey bir domain binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecobb Escherichia coli (strain B / BL21) physical association physical association false false false birc7-diablo-3 pull-down: biotinylated peptide = SMAC, prey = ML-IAP BIR domain 174828 N/A 174835 unspecified role unspecified role prey prey biotin tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false peptide binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 174834 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false bir domain binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecobb Escherichia coli (strain B / BL21) physical association physical association false false false birc7-prss25-1 pull-down: biotinylated peptide = htrA2, prey = ML-IAP BIR domain 174828 N/A 174836 unspecified role unspecified role bait bait peptide binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false biotin tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro N/A 174834 unspecified role unspecified role prey prey bir domain binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecobb Escherichia coli (strain B / BL21) physical association physical association false false false birc4-prss25-2 pull-down: biotinylated peptide = htrA2, prey = X-IAP BIR3 domain 174828 N/A 174837 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false bir3 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecobb Escherichia coli (strain B / BL21) N/A 174836 unspecified role unspecified role bait bait peptide binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false biotin tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro physical association physical association false false false birc4-diablo-4 pull-down: biotinylated peptide = SMAC, prey = X-IAP BIR3 domain 174828 N/A 174837 unspecified role unspecified role bait bait bir3 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecobb Escherichia coli (strain B / BL21) N/A 174835 unspecified role unspecified role prey prey biotin tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false peptide binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false in vitro In vitro physical association physical association false false false birc4-casp9-3 pull-down: biotinylated peptide = caspase 9, prey = X-IAP BIR3 domain 174828 N/A 174833 unspecified role unspecified role bait bait biotin tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false peptide binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 174837 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false bir3 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecobb Escherichia coli (strain B / BL21) physical association physical association false false false birc7-casp9-3 Fluorescence: FAM peptide = caspase 9, prey = ML-IAP BIR domain 174829 N/A 174834 unspecified role unspecified role neutral component neutral component region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false bir domain binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecobb Escherichia coli (strain B / BL21) N/A 174833 unspecified role unspecified role neutral component neutral component fam tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false peptide binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false in vitro In vitro physical association physical association false false false birc7-prss25-2 Fluorescence: FAM peptide = htrA2, prey = ML-IAP BIR domain 174829 N/A 174836 unspecified role unspecified role neutral component neutral component fam tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false peptide binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 174834 unspecified role unspecified role neutral component neutral component bir domain binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecobb Escherichia coli (strain B / BL21) physical association physical association false false false birc7-diablo-4 Fluorescence: FAM peptide = SMAC, prey = ML-IAP BIR domain 174829 N/A 174834 unspecified role unspecified role neutral component neutral component bir domain binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecobb Escherichia coli (strain B / BL21) N/A 174835 unspecified role unspecified role neutral component neutral component fam tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false peptide binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false in vitro In vitro physical association physical association false false false birc4-prss25-3 Fluorescence: FAM peptide = htrA2, prey = X-IAP BIR3 domain 174829 N/A 174837 unspecified role unspecified role neutral component neutral component bir3 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecobb Escherichia coli (strain B / BL21) N/A 174836 unspecified role unspecified role neutral component neutral component peptide binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false fam tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro physical association physical association false false false birc4-diablo-5 Fluorescence: FAM peptide = SMAC, prey = X-IAP BIR3 domain 174829 N/A 174835 unspecified role unspecified role neutral component neutral component peptide binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false fam tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro N/A 174837 unspecified role unspecified role neutral component neutral component bir3 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecobb Escherichia coli (strain B / BL21) physical association physical association false false false birc4-casp9-4 Fluorescence: FAM peptide = caspase 9, prey = X-IAP BIR3 domain 174829 N/A 174833 unspecified role unspecified role neutral component neutral component peptide binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false fam tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro N/A 174837 unspecified role unspecified role neutral component neutral component bir3 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecobb Escherichia coli (strain B / BL21) physical association physical association false false false birc4-diablo-1 Co-IP: bait = X-IAP, prey = SMAC 174830 N/A 174835 unspecified role unspecified role prey prey cleavage region necessary required to bind necessary binding region required to bind mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 174837 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false birc7-diablo-2 Co-IP: bait = ML-IAP, prey = SMAC 174830 N/A 174835 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false cleavage region required to bind necessary binding region required to bind mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false N/A 174834 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false bir binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false birc7-casp9-1 Co-IP: bait = ML-IAP, prey = P35 caspase 9 174830 N/A 174833 unspecified role unspecified role prey prey N/A 174834 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Q96CA5:p.Asp138Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false ML-IAP coimmunoprecipitated processed caspase-9 (P35) but not its zymogen precursor Overexpression of SMAC (Q9NR28) inhibits interaction. SMAC competes with Caspase 9 for binding to ML-IAP. birc7-diablo-6 Co-IP: bait = SMAC, prey = ML-IAP 174830 N/A 174835 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 174834 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Q96CA5:p.Asp120Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false Q96CA5:p.Asp138Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false birc7-diablo-7 Co-IP: bait = biotinylated SMAC peptide, prey = ML-IAP 174831 N/A 174835 unspecified role unspecified role bait bait biotin tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false peptide binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 174834 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Q96CA5:p.Asp138Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. physical association physical association false false false birc4-diablo-2 Co-IP: bait = biotinylated SMAC peptide, prey = X-IAP 174831 N/A 174835 unspecified role unspecified role bait bait peptide binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false biotin tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro N/A 174837 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. physical association physical association false false false birc7-diablo-8 Co-IP: bait = ML-IAP, prey = SMAC 174832 N/A 174834 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Q96CA5:p.Asp138Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false N/A 174835 unspecified role unspecified role prey prey physical association physical association false false false MCF-7 cells stably express ML-IAP WT or ML-IAP D138A mutant. SMAC is endogenous