MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint wang-2001a-4 Caspase-10 is an initiator caspase in death receptor signaling. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. fret fluorescent resonance energy transfer FRET RET FRET analysis FRET RET FRET analysis fret monoclonal western monoclonal antibody western blot monoclonal western Wang J., Chun HJ., Wong W., Spencer DM., Lenardo MJ. Apoptosis - Interactions involving proteins with a function related to apoptosis Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2001 wang-2001a-3 Caspase-10 is an initiator caspase in death receptor signaling. human-jurkat Homo sapiens jurkat Human T cell leukemia fret fluorescent resonance energy transfer FRET RET FRET analysis FRET RET FRET analysis fret monoclonal western monoclonal antibody western blot monoclonal western Wang J., Chun HJ., Wong W., Spencer DM., Lenardo MJ. Apoptosis - Interactions involving proteins with a function related to apoptosis Subclone of Jurkat cell line used (I9.2) - caspase-8 deficient Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2001 wang-2001a-1 Caspase-10 is an initiator caspase in death receptor signaling. human-t-cell Homo sapiens t-cell Peripheral blood T-lymphocytes coip coimmunoprecipitation co-immunoprecipitation CoIp immunoprecipitation Co-IP co-immunoprecipitation CoIp immunoprecipitation Co-IP coip monoclonal western monoclonal antibody western blot monoclonal western Wang J., Chun HJ., Wong W., Spencer DM., Lenardo MJ. Apoptosis - Interactions involving proteins with a function related to apoptosis Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2001 wang-2001a-2 Caspase-10 is an initiator caspase in death receptor signaling. human-jurkat Homo sapiens jurkat Human T cell leukemia crosslink cross-linking study crosslink predetermined predetermined participant predetermined Wang J., Chun HJ., Wong W., Spencer DM., Lenardo MJ. Apoptosis - Interactions involving proteins with a function related to apoptosis Subclone of Jurkat cell line used (I9.2) - caspase-8 deficient Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2001 casp8_human Caspase-8 CASP8 MCH5 ICE-like apoptotic protease 5 MORT1-associated ced-3 homolog FADD-homologous ICE/ced-3-like protease FADD-like ICE Apoptotic cysteine protease Apoptotic protease Mch-5 CAP4 protein protein human Homo sapiens Human MDFSRNLYDIGEQLDSEDLASLKFLSLDYIPQRKQEPIKDALMLFQRLQEKRMLEESNLSFLKELLFRINRLDLLITYLNTRKEEMERELQTPGRAQISAYRVMLYQISEEVSRSELRSFKFLLQEEISKCKLDDDMNLLDIFIEMEKRVILGEGKLDILKRVCAQINKSLLKIINDYEEFSKERSSSLEGSPDEFSNGEELCGVMTISDSPREQDSESQTLDKVYQMKSKPRGYCLIINNHNFAKAREKVPKLHSIRDRNGTHLDAGALTTTFEELHFEIKPHDDCTVEQIYEILKIYQLMDHSNMDCFICCILSHGDKGIIYGTDGQEAPIYELTSQFTGLKCPSLAGKPKVFFIQACQGDNYQKGIPVETDSEEQPYLEMDLSSPQTRYIPDEADFLLGMATVNNCVSYRNPAEGTWYIQSLCQSLRERCPRGDDILTILTEVNYEVSNKDDKKNMGKQMPQPTFTLRKKLVFPSD caspa_human Caspase-10 ICE-like apoptotic protease 4 Apoptotic protease Mch-4 FAS-associated death domain protein interleukin-1B-converting enzyme 2 CASP10 MCH4 protein protein human Homo sapiens Human MKSQGQHWYSSSDKNCKVSFREKLLIIDSNLGVQDVENLKFLCIGLVPNKKLEKSSSASDVFEHLLAEDLLSEEDPFFLAELLYIIRQKKLLQHLNCTKEEVERLLPTRQRVSLFRNLLYELSEGIDSENLKDMIFLLKDSLPKTEMTSLSFLAFLEKQGKIDEDNLTCLEDLCKTVVPKLLRNIEKYKREKAIQIVTPPVDKEAESYQGEEELVSQTDVKTFLEALPQESWQNKHAGSNGNRATNGAPSLVSRGMQGASANTLNSETSTKRAAVYRMNRNHRGLCVIVNNHSFTSLKDRQGTHKDAEILSHVFQWLGFTVHIHNNVTKVEMEMVLQKQKCNPAHADGDCFVFCILTHGRFGAVYSSDEALIPIREIMSHFTALQCPRLAEKPKLFFIQACQGEEIQPSVSIEADALNPEQAPTSLQDSIPAEADFLLGLATVPGYVSFRHVEEGSWYIQSLCNHLKKLVPRMLKFLEKTMEIRGRKRTVWGAKQISATSLPTAISAQTPRPPMRRWSSVS fadd_human FAS-associated death domain protein FAS-associating death domain-containing protein Mediator of receptor induced toxicity FADD MORT1 GIG3 Growth-inhibiting gene 3 protein protein protein human Homo sapiens Human MDPFLVLLHSVSSSLSSSELTELKFLCLGRVGKRKLERVQSGLDLFSMLLEQNDLEPGHTELLRELLASLRRHDLLRRVDDFEAGAAAGAAPGEEDLCAAFNVICDNVGKDWRRLARQLKVSDTKIDSIEDRYPRNLTERVRESLRIWKNTEKENATVAHLVGALRSCQMNLVADLVQEVQQARDLQNRSGAMSPMSWNSDASTSEAS tnr6_human Tumor necrosis factor receptor superfamily member 6 FASLG receptor Apoptosis-mediating surface antigen FAS Apo-1 antigen FAS APT1 TNFRSF6 FAS1 protein protein human Homo sapiens Human MLGIWTLLPLVLTSVARLSSKSVNAQVTDINSKGLELRKTVTTVETQNLEGLHHDGQFCHKPCPPGERKARDCTVNGDEPDCVPCQEGKEYTDKAHFSSKCRRCRLCDEGHGLEVEINCTRTQNTKCRCKPNFFCNSTVCEHCDPCTKCEHGIIKECTLTSNTKCKEEGSRSNLGWLCLLLLPIPLIVWVKRKEVQKTCRKHRKENQGSHESPTLNPETVAINLSDVDLSKYITTIAGVMTLSQVKGFVRKNGVNEAKIDEIKNDNVQDTAEQKVQLLRNWHQLHGKKEAYDTLIKDLKKANLCTLAEKIQTIILKDITSDSENSNFRNEIQSLV q92851-3 Caspase-10 10-C CASP10 MCH4 Apoptotic protease Mch-4 FAS-associated death domain protein interleukin-1B-converting enzyme 2 ICE-like apoptotic protease 4 protein protein human Homo sapiens Human MKSQGQHWYSSSDKNCKVSFREKLLIIDSNLGVQDVENLKFLCIGLVPNKKLEKSSSASDVFEHLLAEDLLSEEDPFFLAELLYIIRQKKLLQHLNCTKEEVERLLPTRQRVSLFRNLLYELSEGIDSENLKDMIFLLKDSLPKTEMTSLSFLAFLEKQGKIDEDNLTCLEDLCKTVVPKLLRNIEKYKREKAIQIVTPPVDKEAESYQGEEELVSQTDVKTFLEALPQESWQNKHAGSNEGSCVQDESEPQRPLCHCQQPQLYLPEGQTRNP May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay. casp8-casp8-3 Homodimerization of Caspase-8 demonstrated by FRET 6338 N/A 6342 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept c-terminal tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false N/A 6342 unspecified role unspecified role fluorescence donor fluorescence donor c-terminal tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false 6353 6350 direct interaction direct interaction false false false Bait tag - cyan fluorescent protein; Prey tag - yellow fluorescent protein casp8-caspa-2 Heterodimerization of Caspase-8 and Caspase-10 demonstrated by FRET 6338 N/A 6342 unspecified role unspecified role fluorescence donor fluorescence donor c-terminal tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false N/A 6343 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept c-terminal tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false 6360 6357 direct interaction direct interaction false false false Bait tag - cyan fluorescent protein; Prey tag - yellow fluorescent protein casp8-fadd-1 Interaction between Caspase-8 and FADD demonstrated by FRET 6338 N/A 6344 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept c-terminal tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false N/A 6342 unspecified role unspecified role fluorescence donor fluorescence donor c-terminal tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false 6367 6364 direct interaction direct interaction false false false Bait tag - cyan fluorescent protein; Prey tag - yellow fluorescent protein caspa-caspa-2 Homodimerization of Caspase-10 demonstrated by FRET 6338 N/A 6343 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false c-terminal tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 6343 unspecified role unspecified role fluorescence donor fluorescence donor region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false c-terminal tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false 6373 6370 direct interaction direct interaction false false false Bait tag - cyan fluorescent protein; Prey tag - yellow fluorescent protein casp8-caspa-3 Heterodimerization of Caspase-8 and Caspase-10 demonstrated by FRET 6338 N/A 6342 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false c-terminal tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 6343 unspecified role unspecified role fluorescence donor fluorescence donor c-terminal tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false Bait tag - cyan fluorescent protein; Prey tag - yellow fluorescent protein casp10-fadd-1 Interaction between Caspase-10 and FADD demonstrated by FRET 6338 N/A 6344 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false c-terminal tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 6343 unspecified role unspecified role fluorescence donor fluorescence donor c-terminal tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false Bait tag - cyan fluorescent protein; Prey tag - yellow fluorescent protein casp8-casp8-1 Homodimerization of Caspase-8 demonstrated by FRET 6339 N/A 6342 unspecified role unspecified role neutral component neutral component yfp-tag c-terminal tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 6342 unspecified role unspecified role neutral component neutral component cfp-tag c-terminal tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false direct interaction direct interaction false false false casp8-caspa-1 Heterodimerization of Caspase-8 and Caspase-10 demonstrated by FRET 6339 N/A 6342 unspecified role unspecified role neutral component neutral component cfp-tag c-terminal tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 6343 unspecified role unspecified role neutral component neutral component yfp-tag c-terminal tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false direct interaction direct interaction false false false fadd-tnfrsf6-1 Fas signalling complex by co-immunoprecipitation 6340 N/A 6343 unspecified role unspecified role prey prey N/A 6342 unspecified role unspecified role prey prey N/A 6345 unspecified role unspecified role bait bait N/A 6344 unspecified role unspecified role prey prey association association false false false Anti-Fas caspa-caspa-1 Homodimerization of Caspase-10 demonstrated by chemical cross-linking 6341 n/a 6346 unspecified role unspecified role neutral component neutral component physical association physical association false false false Cleavage and auto-activation