IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ droin-2000-1 Identification of a caspase-2 isoform that behaves as an endogenous inhibitor of the caspase cascade. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Droin N., Beauchemin M., Solary E., Bertrand R. Apoptosis - Interactions involving proteins with a function related to apoptosis Source of RAIDD (CRADD) taken from PMID 8985253. (A paper by the donor of the construct. The sequence given in the paper is identical to human RAIDD/CRADD). richard.bertrand@umontreal.ca Cancer Res. (0008-5472) 2000 Cancer - Interactions investigated in the context of cancer droin-2000-2 Identification of a caspase-2 isoform that behaves as an endogenous inhibitor of the caspase cascade. human-namalwa Homo sapiens namalwa Human Burkitt's Lymphoma anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Droin N., Beauchemin M., Solary E., Bertrand R. Apoptosis - Interactions involving proteins with a function related to apoptosis Source of RAIDD (CRADD) taken from PMID 8985253. (A paper by the donor of the construct. The sequence given in the paper is identical to human RAIDD/CRADD). richard.bertrand@umontreal.ca Cancer Res. (0008-5472) 2000 Cancer - Interactions investigated in the context of cancer droin-2000-3 Identification of a caspase-2 isoform that behaves as an endogenous inhibitor of the caspase cascade. human-namalwa Homo sapiens namalwa Human Burkitt's Lymphoma anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Droin N., Beauchemin M., Solary E., Bertrand R. Apoptosis - Interactions involving proteins with a function related to apoptosis Source of RAIDD (CRADD) taken from PMID 8985253. (A paper by the donor of the construct. The sequence given in the paper is identical to human RAIDD/CRADD). richard.bertrand@umontreal.ca Cancer Res. (0008-5472) 2000 Cancer - Interactions investigated in the context of cancer casp2_human Caspase-2 Protease ICH-1 Neural precursor cell expressed developmentally down-regulated protein 2 CASP2 ICH1 NEDD2 protein protein human Homo sapiens Human MAAPSAGSWSTFQHKELMAADRGRRILGVCGMHPHHQETLKKNRVVLAKQLLLSELLEHLLEKDIITLEMRELIQAKVGSFSQNVELLNLLPKRGPQAFDAFCEALRETKQGHLEDMLLTTLSGLQHVLPPLSCDYDLSLPFPVCESCPLYKKLRLSTDTVEHSLDNKDGPVCLQVKPCTPEFYQTHFQLAYRLQSRPRGLALVLSNVHFTGEKELEFRSGGDVDHSTLVTLFKLLGYDVHVLCDQTAQEMQEKLQNFAQLPAHRVTDSCIVALLSHGVEGAIYGVDGKLLQLQEVFQLFDNANCPSLQNKPKMFFIQACRGDETDRGVDQQDGKNHAGSPGCEESDAGKEKLPKMRLPTRSDMICGYACLKGTAAMRNTKRGSWYIEALAQVFSERACDMHVADMLVKVNALIKDREGYAPGTEFHRCKEMSEYCSTLCRHLYLFPGHPPT cradd_human Death domain-containing protein CRADD Caspase and RIP adapter with death domain RIP-associated protein with a death domain CRADD RAIDD protein protein human Homo sapiens Human MEARDKQVLRSLRLELGAEVLVEGLVLQYLYQEGILTENHIQEINAQTTGLRKTMLLLDILPSRGPKAFDTFLDSLQEFPWVREKLKKAREEAMTDLPAGDRLTGIPSHILNSSPSDRQINQLAQRLGPEWEPMVLSLGLSQTDIYRCKANHPHNVQSQVVEAFIRWRQRFGKQATFQSLHNGLRAVEVDPSLLLHMLE p42575-1 Caspase-2 CASP2 ICH1 NEDD2 Neural precursor cell expressed developmentally down-regulated protein 2 Protease ICH-1 ICH-1L protein protein human Homo sapiens Human MAAPSAGSWSTFQHKELMAADRGRRILGVCGMHPHHQETLKKNRVVLAKQLLLSELLEHLLEKDIITLEMRELIQAKVGSFSQNVELLNLLPKRGPQAFDAFCEALRETKQGHLEDMLLTTLSGLQHVLPPLSCDYDLSLPFPVCESCPLYKKLRLSTDTVEHSLDNKDGPVCLQVKPCTPEFYQTHFQLAYRLQSRPRGLALVLSNVHFTGEKELEFRSGGDVDHSTLVTLFKLLGYDVHVLCDQTAQEMQEKLQNFAQLPAHRVTDSCIVALLSHGVEGAIYGVDGKLLQLQEVFQLFDNANCPSLQNKPKMFFIQACRGDETDRGVDQQDGKNHAGSPGCEESDAGKEKLPKMRLPTRSDMICGYACLKGTAAMRNTKRGSWYIEALAQVFSERACDMHVADMLVKVNALIKDREGYAPGTEFHRCKEMSEYCSTLCRHLYLFPGHPPT Acts as a positive regulator of apoptosis. casp2-cradd caspase-2 and CRADD (RAIDD) interact in a directed yeast two-hybrid assay 733798 N/A 733801 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 733802 unspecified role unspecified role prey prey physical association physical association false false false 3 A The authors state that the caspase-2L-Pro/procaspase-2L interaction appeared weaker than the caspase-2L-Pro/RAIDD (CRADD) interaction. casp2-casp2 caspase-2 forms homo-oligomers in a directed yeast two-hybrid assay 733798 N/A 733801 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 733803 unspecified role unspecified role prey prey physical association physical association false false false 3 A The authors state that the caspase-2L-Pro/procaspase-2L interaction appeared weaker than the caspase-2L-Pro/RAIDD (CRADD) interaction. casp2-cradd-7 caspase-2 coimmunoprecipitates CRADD (RAIDD) in Namalwa cell lysates 733799 N/A 733801 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 733802 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 3 B The authors state that the caspase-2L-Pro/procaspase-2L interaction appeared weaker than the caspase-2L-Pro/RAIDD (CRADD) interaction. P78560; P42575 transfection casp2-casp2-1 caspase-2L-pro coimmunoprecipitates caspase-2L in Namalwa cell lysates 733800 N/A 733803 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 733801 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 3 C The authors state that the caspase-2L-Pro/procaspase-2L interaction appeared weaker than the caspase-2L-Pro/RAIDD (CRADD) interaction. P42575; P42575-1 transfection