IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ kraynov-2000-1 Localized Rac activation dynamics visualized in living cells. in vitro In vitro fret fluorescent resonance energy transfer FRET RET FRET analysis FRET RET FRET analysis fret predetermined predetermined participant predetermined Kraynov VS., Chamberlain C., Bokoch GM., Schwartz MA., Slabaugh S., Hahn KM. Apoptosis - Interactions involving proteins with a function related to apoptosis Science (0036-8075) 2000 kraynov-2000-2 Localized Rac activation dynamics visualized in living cells. mouse-3t3 Mus musculus embryo cells 3t3 Mouse embryo fibroblast cells fret fluorescent resonance energy transfer FRET RET FRET analysis FRET RET FRET analysis fret predetermined predetermined participant predetermined Kraynov VS., Chamberlain C., Bokoch GM., Schwartz MA., Slabaugh S., Hahn KM. Apoptosis - Interactions involving proteins with a function related to apoptosis Science (0036-8075) 2000 rac1_human Ras-related C3 botulinum toxin substrate 1 RAC1 MIG5 p21-Rac1 Ras-like protein TC25 Cell migration-inducing gene 5 protein TC25 protein protein human Homo sapiens Human MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKRKRKCLLL pak1_human Serine/threonine-protein kinase PAK 1 PAK1 p21-activated kinase 1 p65-PAK Alpha-PAK protein protein human Homo sapiens Human MSNNGLDIQDKPPAPPMRNTSTMIGAGSKDAGTLNHGSKPLPPNPEEKKKKDRFYRSILPGDKTNKKKEKERPEISLPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKSEQKKNPQAVLDVLEFYNSKKTSNSQKYMSFTDKSAEDYNSSNALNVKAVSETPAVPPVSEDEDDDDDDATPPPVIAPRPEHTKSVYTRSVIEPLPVTPTRDVATSPISPTENNTTPPDALTRNTEKQKKKPKMSDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTAMDVATGQEVAIKQMNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETCMDEGQIAAVCRECLQALEFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMIEGEPPYLNENPLRALYLIATNGTPELQNPEKLSAIFRDFLNRCLEMDVEKRGSAKELLQHQFLKIAKPLSSLTPLIAAAKEATKNNH rac1-pak1-3 FRET: GFP-Rac1 and PAK1 PDB domain labelled with Alexa-546 dye 169263 N/A 169265 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) N/A 169266 unspecified role unspecified role neutral component neutral component crib domain binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false cysteine-linked dye alexa 546 label alexa 546 label n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false PAK is labelled with the cysteine-selective iodoacetamide dye Alexa 546 on the added cysteine rac1-pak1-4 FRET in living cells: GFP-Rac1 and PAK1 PDB domain labelled with Alexa-546 dye 169264 N/A 169265 unspecified role unspecified role neutral component neutral component mouse-3t3 Mus musculus embryo cells 3t3 Mouse embryo fibroblast cells N/A 169266 unspecified role unspecified role neutral component neutral component crib domain binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false cysteine-linked dye alexa 546 label alexa 546 label n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false PAK is labelled with the cysteine-selective iodoacetamide dye Alexa 546 on the added cysteine PAK1 is micro-injected in cells