IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ azam-2001-4 Interaction of CR6 (GADD45gamma ) with proliferating cell nuclear antigen impedes negative growth control. mouse-m1-1 Mus musculus m1 M1 human fibrobast murine myeloid cell line anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Azam N., Vairapandi M., Zhang W., Hoffman B., Liebermann DA. Apoptosis - Interactions involving proteins with a function related to apoptosis Coimmunoprecipitation was carried out after IL-6 treatment. lieberma@unix.temple.edu J. Biol. Chem. (0021-9258) 2001 Only protein-protein interactions imex curation Cancer - Interactions investigated in the context of cancer azam-2001-1 Interaction of CR6 (GADD45gamma ) with proliferating cell nuclear antigen impedes negative growth control. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Azam N., Vairapandi M., Zhang W., Hoffman B., Liebermann DA. Apoptosis - Interactions involving proteins with a function related to apoptosis lieberma@unix.temple.edu J. Biol. Chem. (0021-9258) 2001 Only protein-protein interactions imex curation Cancer - Interactions investigated in the context of cancer azam-2001-2 Interaction of CR6 (GADD45gamma ) with proliferating cell nuclear antigen impedes negative growth control. in vitro In vitro anti bait coip anti bait coimmunoprecipitation anti bait coip weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Azam N., Vairapandi M., Zhang W., Hoffman B., Liebermann DA. Apoptosis - Interactions involving proteins with a function related to apoptosis Molecular weight was determined by fluorography. lieberma@unix.temple.edu J. Biol. Chem. (0021-9258) 2001 Only protein-protein interactions imex curation Cancer - Interactions investigated in the context of cancer azam-2001-3 Interaction of CR6 (GADD45gamma ) with proliferating cell nuclear antigen impedes negative growth control. in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Azam N., Vairapandi M., Zhang W., Hoffman B., Liebermann DA. Apoptosis - Interactions involving proteins with a function related to apoptosis Molecular weight was determined by fluoragraphy. lieberma@unix.temple.edu J. Biol. Chem. (0021-9258) 2001 Only protein-protein interactions imex curation Cancer - Interactions investigated in the context of cancer azam-2001-5 Interaction of CR6 (GADD45gamma ) with proliferating cell nuclear antigen impedes negative growth control. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Azam N., Vairapandi M., Zhang W., Hoffman B., Liebermann DA. Apoptosis - Interactions involving proteins with a function related to apoptosis lieberma@unix.temple.edu J. Biol. Chem. (0021-9258) 2001 Only protein-protein interactions imex curation Cancer - Interactions investigated in the context of cancer azam-2001-6 Interaction of CR6 (GADD45gamma ) with proliferating cell nuclear antigen impedes negative growth control. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Azam N., Vairapandi M., Zhang W., Hoffman B., Liebermann DA. Apoptosis - Interactions involving proteins with a function related to apoptosis lieberma@unix.temple.edu J. Biol. Chem. (0021-9258) 2001 Only protein-protein interactions imex curation Cancer - Interactions investigated in the context of cancer ga45g_mouse Growth arrest and DNA damage-inducible protein GADD45 gamma Gadd45g Cr6 Cytokine-responsive protein CR6 protein protein mouse Mus musculus Mouse MTLEEVRGQDTVPESTARMQGAGKALHELLLSAHGQGCLTAGVYESAKVLNVDPDNVTFCVLAADEEDEGDIALQIHFTLIQAFCCENDIDIVRVGDVQRLAAIVGADEEGGAPGDLHCILISNPNEDTWKDPALEKLSLFCEESRSFNDWVPSITLPE pcna_mouse Proliferating cell nuclear antigen Pcna Cyclin protein protein mouse Mus musculus Mouse MFEARLIQGSILKKVLEALKDLINEACWDVSSGGVNLQSMDSSHVSLVQLTLRSEGFDTYRCDRNLAMGVNLTSMSKILKCAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEMKLMDLDVEQLGIPEQEYSCVIKMPSGEFARICRDLSHIGDAVVISCAKNGVKFSASGELGNGNIKLSQTSNVDKEEEAVTIEMNEPVHLTFALRYLNFFTKATPLSPTVTLSMSADVPLVVEYKIADMGHLKYYLAPKIEDEEAS cdn1a_mouse Cyclin-dependent kinase inhibitor 1 Cdkn1a Cip1 Waf1 p21 CDK-interacting protein 1 Melanoma differentiation-associated protein protein protein mouse Mus musculus Mouse MSNPGDVRPVPHRSKVCRCLFGPVDSEQLRRDCDALMAGCLQEARERWNFDFVTETPLEGNFVWERVRSLGLPKVYLSPGSRSRDDLGGDKRPSTSSALLQGPAPEDHVALSLSCTLVSERPEDSPGGPGTSQGRKRRQTSLTDFYHSKRRLVFCKRKP pcna_human Proliferating cell nuclear antigen PCNA Cyclin protein protein human Homo sapiens Human MFEARLVQGSILKKVLEALKDLINEACWDISSSGVNLQSMDSSHVSLVQLTLRSEGFDTYRCDRNLAMGVNLTSMSKILKCAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEMKLMDLDVEQLGIPEQEYSCVVKMPSGEFARICRDLSHIGDAVVISCAKDGVKFSASGELGNGNIKLSQTSNVDKEEEAVTIEMNEPVQLTFALRYLNFFTKATPLSSTVTLSMSADVPLVVEYKIADMGHLKYYLAPKIEDEEGS gadd45g-pcna-2 CR6 coimmunoprecipitates PCNA in mouse M1 cells 572128 N/A 572134 unspecified role unspecified role bait bait N/A 572135 unspecified role unspecified role prey prey physical association physical association false false false 1 D pcna-gadd45g-1 PCNA coimmunoprecipitates CR6 in mouse M1 cells 572128 N/A 572134 unspecified role unspecified role prey prey N/A 572135 unspecified role unspecified role bait bait physical association physical association false false false 1 D gadd45g-cdkn1a CR6 coimmunoprecipitates p21 in mouse M1 cells 572128 N/A 572136 unspecified role unspecified role prey prey N/A 572134 unspecified role unspecified role bait bait physical association physical association false false false 1 D cdkn1a-gadd45g p21 coimmunoprecipitates CR6 in mouse M1 cells 572128 N/A 572136 unspecified role unspecified role bait bait N/A 572134 unspecified role unspecified role prey prey physical association physical association false false false 1 D gadd45g-pcna In a yeast two-hybrid assay HA-CR6 binds PCNA 572129 N/A 572137 unspecified role unspecified role prey prey N/A 572134 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 1 A pcna-gadd45g-2 In yeast two-hybrid assays CR6 binds PCNA peptides 572129 N/A 572134 unspecified role unspecified role prey prey N/A 572137 unspecified role unspecified role bait bait n-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false 2 The interaction between full-length PCNA and full-length CR6 was weaker than the interaction when using PCNA/1-46 or PCNA/ 87-127 peptides. This observation is consistent with full-length PCNA containing in addition to CR6 interacting domain domains that hinder interaction. gadd45g-pcna-3 In yeast two-hybrid assays CR6 peptides bind PCNA 572129 N/A 572137 unspecified role unspecified role prey prey N/A 572134 unspecified role unspecified role bait bait c-terminal required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false 3 The binding affinity to PCNA of the CR6/76-159 C-terminal peptide was higher than the full-length CR6. pcna-gadd45g CR6 coimmunoprecipitates with PCNA 572130 N/A 572137 unspecified role unspecified role bait bait region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 572134 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro direct interaction direct interaction false false false 1 B, 4 A Viewing figure 4 A, it seems that PCNA (87-127 aa) coimmunoprecipitates HA-CR6 but PCNA (1-46 aa) does not (unlike what is stated in the text), although PCNA (1-46 aa) is coimmunoprecipitated with HA-CR6. pcna-gadd45g-3 CR6 coimmunoprecipitates with PCNA 572130 N/A 572134 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 572137 unspecified role unspecified role bait bait region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro direct interaction direct interaction false false false 1 B, 4 B gadd45g-pcna-1 PCNA coimmunoprecipitates with CR6 572131 N/A 572137 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 572134 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro direct interaction direct interaction false false false 1 B, 4 A gadd45g-pcna-4 PCNA coimmunoprecipitates with CR6 572131 N/A 572134 unspecified role unspecified role bait bait region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 572137 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro direct interaction direct interaction false false false 1 B, 4 B gadd45g-pcna-5 HA-CR6 coimmunoprecipitates PCNA in 293T cells 572132 N/A 572137 unspecified role unspecified role prey prey N/A 572134 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false 5 B pcna-gadd45g-4 PCNA coimmunoprecipitates HA-CR6 in 293T cells 572133 N/A 572137 unspecified role unspecified role bait bait N/A 572134 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false 5 B