IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ antonsson-2000-1 Bax oligomerization is required for channel-forming activity in liposomes and to trigger cytochrome c release from mitochondria. ecoli Escherichia coli (strain K12) molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Antonsson B., Montessuit S., Lauper S., Eskes R., Martinou JC. Apoptosis - Interactions involving proteins with a function related to apoptosis E. coli cells disrupted in buffer containing 1% Triton X-100 bruno.antonsson.ch-gva03@serono.com Biochem. J. (0264-6021) 2000 antonsson-2000-2 Bax oligomerization is required for channel-forming activity in liposomes and to trigger cytochrome c release from mitochondria. mouse-liver Mus musculus liver liver molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Antonsson B., Montessuit S., Lauper S., Eskes R., Martinou JC. Apoptosis - Interactions involving proteins with a function related to apoptosis E. coli cells disrupted in buffer containing 1% Triton X-100 bruno.antonsson.ch-gva03@serono.com Biochem. J. (0264-6021) 2000 bax_human Apoptosis regulator BAX BAX BCL2L4 Bcl-2-like protein 4 protein protein human Homo sapiens Human MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGTPTWQTVTIFVAGVLTASLTIWKKMG bax_mouse Apoptosis regulator BAX Bax protein protein mouse Mus musculus Mouse MDGSGEQLGSGGPTSSEQIMKTGAFLLQGFIQDRAGRMAGETPELTLEQPPQDASTKKLSECLRRIGDELDSNMELQRMIADVDTDSPREVFFRVAADMFADGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLVWIQDQGGWEGLLSYFGTPTWQTVTIFVAGVLTASLTIWKKMG baxa-1 Oligomerisation of BAX identified by gel filtration 240507 N/A 240509 unspecified role unspecified role neutral component neutral component region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 8.0 physical association physical association false false false In the presence of 2%OG in the migration buffer BaxDC migrated as an oligomer of approx. 160000 Da. In the absence of detergent migrated at a molecular mass of 22000 Da (monomeric). baxa-2 Oligomerisation of BAX identified by gel filtration 240508 N/A 240510 unspecified role unspecified role neutral component neutral component Stoichiometry: 6.0 physical association physical association false false false in the absence of detergent, Bax migrated as a 24000-Da protein (monomer). After pre-incubation of the cytosol with 2% OG, Bax migrated with a molecular mass of 140000 in the presence of 2% OG in the migration buffer